CAZyme Information: KAG5418079.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5418079.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1025	JAEOAQ010000006|CGC3	117254.52	6.6728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000006:493770-496847(+)

Full Sequence      

MSHNPFEYVSDDDLFDDVDTVQQPTPSVTEHSQISGYHHIQRPNERIPSEGSSSSSHLGQ
GHYTSKQERFRYPTHSSSVGTAVSDEEKKYNEKYFPDNDDDDMFHDYDVPKREKTVSFKN
DLKYPPLAYNPGLDNPFYENYKDYGTDHEQLVYNMNHPAFSTGEDYLINPLVDAEYEDDE
DFDIYGDDDSLFSGDAGDILRRNTTLNRGRLGTSMRKTRSRGSTITFDDDYDEKGHNLKY
TKTIKKARLINGNYIIDAPAPKALLDTYCKKIGDTGREMSFLRYTAATCGPSNYIKFKYN
LRQALYEPRRETEIMVCITMYNEDEVLLARTLKGIFDNIEDLRKRSDPVWGDDSWKKIVV
CIVSDGRMHLNKRTQILLSALGLFQDGYAKSKINDKPVKAHIYEYTSTVGIDTINDHIHL
APNSTPVQFLFCLKEKNARKINSHRWCFQAFAPILNPKVVMLLDCGTKPSKDAFYYLWRA
FKDPNVAGACGEMRASLGTGKRLLVNPLVAAQNFEYKISNILDKPMESVFGFISVLPGAF
SAYRYEALLNVNGKGPLEKYFKGEYSNMNNQVDDPDDDDEKEVKERNFQEAGIFTSNMYL
AEDRILCFELVAKKDHKYMLRYVKEAKAETDVPESIDEFVLQRRRWLNGSLFAAAYAVFH
WTKLWRSKHSLLRKLFLQLEFYYQLVTLLVSWFSLASFFLVFRILTANLGAKDMHFETGK
YLGIIFLWIYVGSIVCTFVLAFGNTPRGTRKFYQVIAYLFAIMMAYLIFAAIFLAVHTAQ
AIIKDHKHDFTASMVFTNTKFRDLVVSVVSTYTLYFVGAFIYGEPSFMFTSFAQYVLLSP
TYINVLNIYSFCNIHDVSWGTKGVERAKDLGSAKSMGEDKENILLVAPDTNEGLNDTYLD
KVELLRSMPPEEVDIAQAKSIKDDSYYAFVRTITVLIWMLTNAILIAVVLDAAGVGLITN
KSSTNADGSISGNSEVFLTIILWIVAGMAVFRFVGAILYLITKEFRPLKWKWRAHRENKK
IRSQG

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	320	481	8.1e-68	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	9.46e-95	320	481	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	8.25e-87	316	653	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.06e-30	430	770	115	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	2.08e-28	246	319	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	6.80e-17	429	553	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44069.1|GT2	0.0	1	1024	1	1028
CCG23479.1|GT2	0.0	1	1024	1	1018
AOW28121.1|GT2	0.0	2	1024	11	1101
AAO37822.1|GT2|2.4.1.16	0.0	2	1024	11	1101
CAX42595.1|GT2	0.0	2	1024	11	1104

PDB Hits     

KAG5418079.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	3.58e-281	241	1009	234	1002	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30601|CHS2_EXODE	5.52e-247	229	1003	165	916	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30583|CHSC_EMENI	1.01e-241	238	1006	171	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30588|CHS3_NEUCR	8.68e-232	238	1006	144	886	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|Q12564|CHSA_AMPQU	3.10e-229	238	1003	157	897	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

Start	End
680	702
723	745
755	777
804	822
832	854
927	949
979	1001