CAZyme Information: KAG5417871.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5417871.1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901	JAEOAQ010000007|CGC2	102272.63	6.1929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000007:2123333-2126038(+)

Full Sequence      

MFISDALNSARYAQDAVSEKVRLYSATSAISPVGVKPLRRSYSISDPIADTDNTGTSILE
CVPLETDKNGNFYDPSTGRIVVLKGINMDAQMKLPAEPYMPSYRGDPTDPNDIFFEGDTV
SFVGRPFPLEDARSHFERIKTWGYNTVRYLLTWEAIEHEGPGKYDQKFADYTLKVLKIIG
EVGGLYVILEFHQDVWSRYSGGSGAPMWTFYAAGLDPKKFTLADSAILHNEPRFRDGSDI
YHKMLWTSNYKRLAPLVMFTMFFAGKHYFPKLIMNGENIQDYLQNHYLGSVEFIWKHICN
GVPELINNGAILGFESMNEPNCGLIGYPDIGYLPDFQQLRVGTTPTAFQSMKLGMGFACE
VDEYRITVTGPRKYGTKIVDPKGVGAWLTPEDAISIDAHYGFKRSKEWELGTCIFAAQGI
WSWPQVVSDMQAMSQEQRLDVSSKCKVLEPHYFSKSMPQHNYESHISAVDTHTFVNYHFV
DHIIRFKEVIRKYRPDAFVMLSTPVLEEPPHLKGDERNIIDDKVIYCPHYYDGLSLMHKS
WNFKFNVDTLGIMRGAYLNPVLGIVFGGRAIRNCFQKQFCEMRRECNEYLGKIPILMSET
GMPFDMDDKRSYRNGKYISQTAAMDALCNALESANMSHTFWCYDSCNNHKYGDNWNNEDF
SFWSPDDRNLTFEDECPTPEIRNETESERSRVRASRAMRKANRKLKRAAKMGRSGSVDST
TSTTSHSSSDAYSDMDSDSTTSSSVISSTSSNVYRRQYGKCYPSPDGVRAPGAVIRPYLM
ASLGQIVAIEFDIKAVKLSLQVSIDKSDPRVEDTPTIIFVPKWHFPFLDYGDIFLTSGYV
KYNEELQYLEWYHCSDPSLADKEAPTTNEKTSIETIIIKNNSGSLEDAKAIENRKLGCTI
S

Enzyme Prediction     

EC	3.2.1.21:3	3.2.1.45:1	3.2.1.104:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	77	649	1.8e-212	0.9944341372912802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	2.04e-08	776	853	1	76	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
225344	BglC	6.83e-05	136	308	79	259	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.46e-04	139	254	33	147	Cellulase (glycosyl hydrolase family 5).
402763	DUF3114	0.006	214	253	130	169	Protein of unknown function (DUF3114). Some members in this family of proteins with unknown function are annotated as cytosolic proteins. This cannot be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG24256.1|GH5_12	0.0	1	901	1	904
CCE39978.1|GH5_12	0.0	1	901	1	904
AOW29940.1|GH5_12	0.0	7	901	1	897
CAX41875.1|GH5_12	0.0	7	901	1	898
AAV03081.1|GH5_12	0.0	91	901	5	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	4.16e-130	73	885	28	775	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
6JYZ_A	3.93e-07	62	324	22	227	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40566|EGH1_YEAST	1.14e-177	69	853	10	729	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	1.36e-167	72	853	13	719	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	4.99e-94	62	664	13	548	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	6.04e-70	70	668	20	561	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999915	0.000154

TMHMM  Annotations     

There is no transmembrane helices in KAG5417871.1.