CAZyme Information: KAG5416858.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5416858.1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936	JAEOAQ010000008|CGC2	104342.37	6.8179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000008:159650-162460(+)

Full Sequence      

MEEKAGQLLCGGFQGTKVTSQAYKLIVDHKISSMILSRKNAVSVEQMSKLIKDLQYIAYT
QGDYKYPIMFAIDQEGGIMNSLFDPDFLTQYPSAMALAATGDPKLVYEISRAIAIELKAI
GFSIILGPVLDVVTKLSHQLVGVRSFGTTVEDVQKYGSSCAKGLRDGGLFTMGKHFPGIG
NATVDSLLELPMMGDTLNQIRQSNAAPFAHLIHANLLDGISVAGCGVPNISPDEAHACLS
PVIINQLLRQEIGFNGVVISECLEMEALYHSIGLGQGVILAINAGCDLVMVCHDLKLQNE
AIDSIKKGIINGNLDDDTVLASFERIETLQKKLPTWKEIFPDGITSAQESPVLFKYKCPD
QWKRHQELASLAYQKSITLVRDYGGLLPLSKHFEQSSELESILVLSPLLSPIAPKQASTE
SLFTGEEVFQGFGKFLSKHQVNAKKKYVVLHTTYTANGLTPLHESLIEKANIVVVFTSEA
SRNMYQIGIVKYVSVLCGASPALSKRSASKLQKPLIVVATSSPYDFFYDKLMGSVYICCY
DYTKQALENVASLLLGDFEPQGCIPGEQQHAKKRRHSHDDVNMKQIKRKWLVDEFDIARD
LSGLVKLLKDVEWEDEDGVNIKDEQYCKRLGGLLATSNQKHFVVRNSSLNILYGAVLTWC
EGTIGHVLFIIVEKSKRLHSIGRNLNARAERYLTREKNCTEIRLGSAFPLVVFGNLCSGS
RTFLRRVGWEDEKSPKKCVLRLNDISQWSVPERILKELMIVGVRFDVCTGSSQLERLIER
GDLSPEYKAYYKEAMKNTPSRLAHEVKIIIALEPSSSIVIGSVILFTNKSEFSKFFPFID
QCIDDEQRGSSTVPTIGGIIAPVIDQSYSNLVDIFKYGLICSAITKLKNSLNDEDMLNQC
IMCDVVDDEKTITSMRDIGFEKWRYYYDYYDKKMCQ

Enzyme Prediction     

No EC number prediction in KAG5416858.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	64	291	1.9e-48	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.05e-66	1	392	3	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.00e-56	1	329	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.20e-37	34	338	29	315	beta-hexosaminidase; Provisional
178629	PLN03080	7.48e-05	246	584	282	604	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG20453.1|GH3	0.0	1	936	1	943
CCE41502.1|GH3	0.0	1	936	1	941
AOW30790.1|GH3	0.0	5	930	6	948
ABN65475.2|GH3	0.0	6	933	12	1001
CAX39562.1|GH3	0.0	5	930	6	945

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	8.73e-68	1	754	9	702	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.23e-59	1	565	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.91e-39	1	565	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.08e-39	1	565	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.12e-38	1	565	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.04e-38	1	565	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q5QUZ5|NAGZ_IDILO	8.78e-34	15	304	10	289	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
sp|B4EVE7|NAGZ_PROMH	3.82e-30	14	305	9	292	Beta-hexosaminidase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=nagZ PE=3 SV=1
sp|A7MFT1|NAGZ_CROS8	9.10e-28	14	305	9	292	Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=nagZ PE=3 SV=1
sp|Q5FA94|NAGZ_NEIG1	9.78e-28	17	303	19	300	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG5416858.1.