CAZyme Information: KAG5416801.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5416801.1
• CAZy Family: AA4|AA7
• CAZyme Description: mndB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		96475.88	4.6688

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000008:36987-39488(+)

Full Sequence      

MSVLTNWTFRQGPIQQDLVPPVLTETWYNATPDQQSHQIHIDLMYYNLIPDPFINDNELN
VSWVSDLTWEYRCLFDVPDAIYNNQPAFLFFDQLDTEAIVELNNDVILQSENAFQMYKVA
VNVSRQNELKIRLKSGFELGKSLENQFGVEECWNGDCSRVYVRKPQFQYGWDWGPNLITT
GFNKVSLVTGTFIDDFYVRYDLNNELDLAFLWFEIDSVLIDTVDEGRIEIELGDETIDVV
KIDHVESKMNISHILEDVQLWWPIKHGSPTLYNIKLFFDDKLMVTKSIGFRKVELITMPD
DIGSSFYFKINNKPIQMLGSNWIPSHSFQSQVTQQDYQRYIDLIVDSNQNMVRVWGGGQY
EGDEFYKLCDEKGILVWQDFMFACGIYPNKSILTSVESEVVCQVKRLRNYASVVIYAGNN
EDYQIADALKLDTSNASQFPAKYIYEVLIPSVVSHLVNNQVSYRYGSPYSDPTHSSYDLR
FGDSHQWDVWHGRQLPYQAWPQLSARFVSEFGMLALPLYSTLHKYITNVSELYPNSEMIK
FHTKAANKENLNHYVWSNFNKPVKSKLGLREWIYLTQLMQSEAVSLAFRYWRRQWDQFQC
DGVLVWQLNDCWPSVSWSVVDFEKVPKLSYYGMKRELSEISVAGYKSERIGHGVEHGGQL
VFQAPSLAFDVWGFGSGFNLTLTVQFYNSDGILVDESIQNGIDFKENRVNTLMKGANFDH
LKNDTIVYLKLSKDGGVTIARSSDWPQPLKSIGWQRLCSNLQIDTKYQGMGELLISTNKP
VKGLQLYFDSADDNGQWFSDNGIDLFPNNPQVIKVTGLQEEDLDKLKYRYLDY

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	647	2.5e-70	0.613031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.44e-52	23	631	30	624	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	1.76e-07	191	291	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	4.56e-05	182	376	198	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
407658	Mannosidase_ig	7.98e-04	678	750	15	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
407625	Ig_mannosidase	0.001	772	827	16	68	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG20510.1|GH2	0.0	1	833	1	833
CCE41561.1|GH2	0.0	1	833	1	829
CAX39789.1|GH2	2.08e-298	4	831	5	812
AOW31022.1|GH2	3.43e-287	4	831	5	813
ABN65300.2|GH2	9.70e-240	3	822	4	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.59e-112	39	642	52	658	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.60e-88	1	817	9	818	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.67e-88	1	817	11	820	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.70e-88	1	817	11	820	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.35e-88	1	817	9	818	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYN2|MANBB_ASPNC	6.28e-156	39	831	36	842	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	1.26e-151	5	831	11	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|I2C092|MANBB_THETO	4.73e-151	6	831	12	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|B8NW36|MANBB_ASPFN	4.92e-151	5	831	11	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	4.04e-149	2	831	8	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000027

TMHMM  Annotations     

There is no transmembrane helices in KAG5416801.1.