CAZyme Information: KAG5305522.1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: KAG5305522.1
• CAZy Family: GT71
• CAZyme Description: DUF821 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	JAEVHI010000001|CGC8	53275.87	8.5268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG184AR	12723	N/A	3308	9415

• Gene Location: location=JAEVHI010000001:9589535-9591008(-)

Full Sequence      

MLLRQKWYTRVVLPCFVVLFGAFVFTIWFGMNSDQDNVHPIITQLIPAGHCTCEYSTTFN
CTSCLAPIDYPIRTMSEPKQWVFQYGRDDRNEGLSGNQCRAAFPGLFEDVNRAVKYWRHL
GGLTEKQLNVINLRNGMARGMINGGELYVVETRAAQEDHRRKILGIFSSIYRALPADRRG
LPDIEFIFSIEDRLDDIKGSGQPIWVLGRKASEESVWLMPDFGFWAWHNPSVVIGTYDEV
VRKIEQREDAIPWALKQRKLVWRGSLNYAPKMRRRLLEVARGKTWGDVKEIMWSSKNNLI
SMEDHCNYMFIAHVEGRSFSSSLKYRQTCRSVVVSHKLQFIQHHHYLLQAEGPHQNYVEV
ERDFSDLEQKLEALLQDREQTKRIADNSVKVFRKRYLTRAADACYWRELINGWGTVFSHS
SNYSQPEVQGGLRAARGYRYESFLLLPSEEMMDLSHPI

Enzyme Prediction     

No EC number prediction in KAG5305522.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	181	416	2.9e-20	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.01e-17	180	414	1	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.47e-14	181	414	79	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS76484.1|GT0	0.0	1	458	1	458
BCR89787.1|GT0	3.18e-180	10	456	13	454
QMW31614.1|GT0	1.16e-177	22	455	29	459
UDD60541.1|GT0	1.16e-177	22	455	29	459
QRD90629.1|GT0	5.05e-176	22	455	140	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	9.34e-08	181	333	128	297	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	4.91e-07	181	333	140	309	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	1.12e-06	181	419	138	390	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	1.14e-06	181	429	138	398	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000001

TMHMM  Annotations     

Start	End
7	29