CAZyme Information: KAG5305145.1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: KAG5305145.1
• CAZy Family: GT58
• CAZyme Description: BNR/Asp-box repeat domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	JAEVHI010000001|CGC23	38831.92	6.5005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG184AR	12723	N/A	3308	9415

• Gene Location: location=JAEVHI010000001:8507969-8509033(-)

Full Sequence      

MMKLASKFMQIFGLATPSPFDNIRGELVIGDEINISNLPASYVRLAKLSNGSVLAGFTIN
EGGVKVIKTSKRTNGDQRFSPFGEITRGDWDIGNIYLLEVAPSVVLGAFRNHTSVGPNLI
HSRITVCKSTNGGKDWKFASQAFEMDGNLGAWEPFMRLAESNPNEIQLTYSQEFAANEQR
TMLVTSTDRGDTWSTPKAVSWKPKQRDGMTGIAKTKDGNRDALVMVFETTDNMPFFNVKA
AISYDDGASWCHRQDVQVAPRGKNAGAPQIASFADGSLIVVYMADEDIEGNWPHKANIKA
TFSGPPKDGKMCWSPPQVVKEADAFWPGALQFEDSTVMVTYDADGARAKTIRLN

Enzyme Prediction     

No EC number prediction in KAG5305145.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	40	293	3.7e-52	0.8794788273615635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	4.77e-09	129	291	179	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.78e-08	120	317	43	241	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.008	123	250	123	251	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS76105.1|GH93	3.09e-266	1	354	1	354
QSS58347.1|GH93	8.16e-252	2	354	1	354
QSS53313.1|GH93	4.70e-247	15	354	36	375
BCS24955.1|GH93	6.90e-105	17	354	26	365
EAA62412.1|GH93	8.41e-104	31	353	44	366

PDB Hits     

KAG5305145.1 has no PDB hit.

Swiss-Prot Hits     

KAG5305145.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KAG5305145.1.