CAZyme Information: KAG5293190.1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: KAG5293190.1
• CAZy Family: GH13|GH13
• CAZyme Description: GDSL Lipase/Acylhydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	JAEVHI010000004|CGC5	20401.17	7.1030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG184AR	12723	N/A	3308	9415

• Gene Location: location=JAEVHI010000004:427548-428240(+)

Full Sequence      

MMRKWLARHSWITSSAFSVQSNGSMMNVPPLDLLPLYALPEMGGVETSTFWPDKPANSTE
VSCRMKQTVVAVNEIIRLKMEGSMRHRYKGASVALFDTHSLLTNIYGHPAQYFNGTEPPN
VQSWVKQCDAQGQNCVEQPSRDSYMWYDAIHPSEQTDRIIAQHFVQVVKGLSPYTHYFE

Enzyme Prediction     

No EC number prediction in KAG5293190.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	25	164	3e-22	0.4044943820224719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.71e-20	26	167	151	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.02e-08	69	166	207	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	2.09e-06	90	167	203	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
178701	PLN03156	0.001	139	169	317	347	GDSL esterase/lipase; Provisional
225780	COG3240	0.003	58	162	228	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS54699.1|CE16	8.73e-110	25	179	197	351
QSS59641.1|CE16	1.17e-107	25	179	197	351
BCS15697.1|CE16	9.83e-45	25	179	199	355
BCS04097.1|CE16	9.83e-45	25	179	199	355
UJO14737.1|CE16	5.62e-44	25	177	217	370

PDB Hits     

KAG5293190.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	1.96e-24	25	179	190	346	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000007

TMHMM  Annotations     

There is no transmembrane helices in KAG5293190.1.