CAZyme Information: KAG4306358.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4306358.1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	JABTEG010000001|CGC1	85409.91	9.1959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000001:537665-540406(+)

Full Sequence      

MESTLRNREKKEETVQEIPENSDEEKYPPEPSCFSTNILFLVIFILSILTRFYRIQHPSE
VVFDEVHFGKFLSLYLKRSYFFDVHPPFTKLLYAFFGWIIGYDGHFLFEKIGDSYIKNNV
PYIYLRSVPAFAGAMVVPLVFLIMKDSGHSLLSSTLAASLVLFDNAHVAQSRLILLDSVF
IFLMTSSIYCYVRFSKLNNHRFSLSWWKWLFLTGVFLSCTISTKYVGLFTYVSIGVLVAI
ELWDILDIRKGYTIHYFVINFISRAFCLIVFPFILYLVWFYIHFNVLSKTGPGDRFMSPS
FQKTLEGNILSTSSLQVNYYDKITIIHKETDAYLHSHNATYPLQYEDGRISSRGQQVTGY
KHNDSNNHWIIIPAHFSNETLLGKPVLNNDYIRLKHVLTNTYLLTHDVASPKYPTNQEFT
TVLGEKTRYEETIFQIKLEYQEDKAVLKTKGSRFKLIHNLTRVAMWSDIGPLPDWGFKQQ
EINGNKKLKEERNIWIIDDIIDFNDTNRTINEPLENLSFFKKYIELQFSMFRHNSKLKGH
HPYSSYPLDWPLLNRGISFWTNSSQTQQIYLLGNPVGWWFEISFIFIFVIVIILDQVLLR
RGLILIRESRKLFYTYTLFFFLFWVIHYFPFYLMGRKLFLHHYLPAHVASSLLTGSTFQL
LDKLNSKKLNSPKKAKLMFIILIGSLLGSFIFFSPITYGTPGLTPRQLYERKWSPNWDYA
YLEDSYE

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	42	284	1.4e-66	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	10	723	1	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	3.00e-72	42	288	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.86e-61	521	713	1	196	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.01e-16	335	491	13	181	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	8.30e-10	317	374	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64374.1|GT39	0.0	1	717	1	755
VBB72720.1|GT39	1.94e-247	31	713	41	763
CDP23606.1|GT39	2.01e-247	31	713	42	764
CAP69590.1|GT39	2.01e-247	31	713	42	764
BCS21332.1|GT39	2.08e-247	19	713	27	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.30e-93	38	719	51	729	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.54e-84	2	720	20	754	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	3.14e-06	317	418	7	101	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	1.05e-227	38	725	60	778	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	2.19e-209	42	713	58	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	4.50e-207	28	713	39	746	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|F1QF89|POMT1_DANRE	6.43e-110	37	718	15	714	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q29IL2|POMT2_DROPS	4.84e-104	38	719	39	749	Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=tw PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000016

TMHMM  Annotations     

Start	End
33	55
80	102
122	144
173	195
202	221
226	248
261	283
577	599
612	634
677	699