CAZyme Information: KAG4306253.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4306253.1
• CAZy Family: GT50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1588	JABTEG010000001|CGC3	181343.29	9.0601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000001:905787-911519(-)

Full Sequence      

MTVAPLRIVKKHNSNASPPLLPQPIHEILQDLSLSTQKENTNISHDFTYCRVIYAFSIEQ
SDASYLKLERDQIIHVHFQHFSGWTDGTLIATNSRGWFPLKYTEPYILMAVRPVVAASHG
LYALFSSHKYEEYAIGISNLIFGVRQLLIRANSLSHEALVVKNDPAIRQKRKTLLSELDN
LVSITKNVSKQSSNHTINAKLSNELIFLLGRIVLLSKQFAHMIGPEKEACDEPLSSPTLS
LNSEFSENIYMHHRIASVDSSSFASLDEQTDKIYSGSLDSHQSSKSSLNSQTYCNPVNIL
HNLTVANEDFLSHLASFIGRLHLHSHTSSQLLLTTKQCVYTARELLSVIEPVSIKHPDAQ
LYIAKENFYTKITSFVAIVKKVITTHCSTNTSNEQNTIDKSESKKLIDAAANCVSGASQC
VTRAKFILETIGGSSISTPLYKQGNFSQSTSVNTLSSKSSQTTFENTSPQEAYKSYNTFL
TSPPLKLSSNIHEAEKKGVLNEYSISSKNTSQEPINNKDNSSYLNDNADLNTKQILNKCR
KGSSELSHGLLIKPPTLFSTCSSSTSECNEKAMLDSKLKTHHDLPSGTASSFASSERFSI
TSSYVEHISSPATSPEPVELDTISRNKEEKKNSKHILLNNEGQVIGATLYALVERMTMHD
TTPDAVFASTFYLTFRLFTTPRELALVLLERFPTEKTVDADHNWDHYYAMPVRLRTWMDN
YWHKSSDEEALSIIRDFSCQLHKYLPQVSSRFDELVNKISSKTSQNTHSTNISRKVYNLS
NKSMHSDLSIPPVIISKNLRTQLRTASFEDNPDSFSIIDFDPLEIARQLTLKESKLFCSI
LPEELVKLGTSRKANASTTVKAMAALSTDIAGWVVESILSQNDIKKRAAVMKQWIKIGNK
CLELSNYNTLMAIVSALNSSTISRLKKTWNALSTKSKNIFENLRSITDYSRNYAVYRSRL
KEHFPPCLPFLGLILTDITFIEEGNPSYRSFKNSSALHPIQLINYDKYIKIYSIISKLQQ
FQVPYKLEFVEGLQTWIESQISCVRMKGQNNVTELWRRSLALEPKIQSQSSQQNDQTKNS
TDNSILTVSEMVEDSDAKKHCYNIFSEEYVTPVSIFIQIMILGPLCIYILIKTYKKLYTK
SKKIRSFFHPYCNSGGGGERVLWTAIKAIQDKYNNIICVIYTGDVNSKKEDILTKTKTIF
DIELDEKRTQFIYLYKRYYISSEQWPRFTLLGQSLGSLILAYEAINQCVPNIFIDTMGYA
FTYPLISFCLDIPIVAYVHYPTISTDMLSKVPYRRIFKYIYWKFFSFIYSFCGHYAHLVI
TNSSWTQNHMESLWKKKKEILTIYPPCNTKDLYNSNINNNKREKLIVYLAQFRKEKNHIL
LLKSFKTMLDTYPETKNYGIKMVLIGSTREDDELYIDSLKSMIKSLNISSYVLFAHNLPW
NEVVEWLRKSWIGVNTMWNEHFGISIVEYMAAELIPVVHDSGGPKLDIVIDYEGKPTGAN
KKYTIMHTLIVYLGYRATTPSSFAKAFKDIFSMSQEECNFMRKRARMSSTRFSEEKFQES
WLNIMNILLKYEKAYRHKRIDRTKFKEY

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1358	1489	6.7e-27	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	1147	1560	5	419	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	4.41e-124	1147	1569	38	458	transferase, transferring glycosyl groups
406369	ALG11_N	1.12e-114	1147	1334	5	208	ALG11 mannosyltransferase N-terminus.
395492	RasGEF	1.22e-69	824	1008	1	178	RasGEF domain. Guanine nucleotide exchange factor for Ras-like small GTPases.
214539	RasGEF	6.10e-63	817	1066	1	242	Guanine nucleotide exchange factor for Ras-like small GTPases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65024.1|GT4	1.07e-238	1103	1588	13	508
CAA20913.1|GT4|2.4.1.131	2.08e-122	1134	1570	44	465
NP_587708.1|GT4|2.4.1.131	2.08e-122	1134	1570	44	465
EGX46298.1|GT4	8.37e-122	1144	1569	91	526
AIT18233.1|GT4	9.10e-118	1147	1562	60	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BKD_S	8.61e-35	648	1065	38	452	Complex Of Human H-Ras With Human Sos-1 [Homo sapiens]
1NVU_S	9.17e-35	648	1065	40	454	Chain S, Son of sevenless protein homolog 1 [Homo sapiens],1NVV_S Chain S, Son of sevenless protein homolog 1 [Homo sapiens],1NVW_S Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS [Homo sapiens],1NVX_S Chain S, Son of sevenless protein homolog 1 [Homo sapiens],4NYI_S Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange [Homo sapiens],4NYJ_S Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange [Homo sapiens],4NYM_S Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange [Homo sapiens]
5WFO_N	9.32e-35	648	1065	41	455	Ligand-bound Ras:SOS:Ras complex [Homo sapiens],5WFP_N Ligand-bound Ras:SOS:Ras complex [Homo sapiens],5WFQ_N Ligand-bound Ras:SOS:Ras complex [Homo sapiens],5WFR_N Ligand-bound Ras:SOS:Ras complex [Homo sapiens],6BVI_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6BVJ_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6BVK_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6BVL_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6BVM_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6CUO_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6CUP_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6CUR_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D55_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D56_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D59_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5E_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5G_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5H_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5J_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5L_B Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5M_S Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5V_S Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6D5W_S Ras:SOS:Ras in complex with a small molecule activator [Homo sapiens],6V94_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9F_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9J_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9L_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9M_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9N_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens],6V9O_B Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods [Homo sapiens]
1XD2_C	9.62e-35	648	1065	40	454	Chain C, Son of sevenless protein homolog 1 [Homo sapiens]
4URU_S	1.01e-34	648	1065	43	457	The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4URV_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4URW_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4URX_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4URY_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4URZ_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4US0_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4US1_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens],4US2_S The crystal structure of H-Ras and SOS in complex with ligands [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74878|ALG11_SCHPO	3.70e-123	1134	1570	44	465	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg11 PE=3 SV=1
sp|Q2TAA5|ALG11_HUMAN	4.55e-105	1119	1570	25	492	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
sp|Q5R7Z6|ALG11_PONAB	1.61e-104	1119	1570	25	492	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG11 PE=2 SV=2
sp|Q8X092|ALG11_NEUCR	2.04e-103	1136	1562	92	537	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-11 PE=3 SV=1
sp|Q3TZM9|ALG11_MOUSE	2.77e-103	1119	1569	25	491	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
1109	1131
1225	1242
1257	1279
1299	1321