CAZyme Information: KAG4305512.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4305512.1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		91815.05	6.7354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000003:611573-614512(+)

Full Sequence      

MGLNFIWFLLLSFYIKISAIESKEKKIIQEAEIASNASLLWGPYRPNLYMGIRSRNPETI
LAGIMWTGLDNYAQIHRIRHTCEQNDDMEMHGWQEFDVRTGGRQIIKDKDMNIEIVTEFV
KTYTEKQAGNWGLRIKGKPKKANSKTSVFFYVASNYDEIKLDSKLQKQGIEGSVFFTSKT
SKKFTIEITQGPSTNIYPSFNHSSANEKHLNKSMYSSIMVPKENIWMTKDLLFSILNKNI
YNYQKYIEDIPPPAIFYTLPNIGGQGNLHFVQKVFEGSFEFDILYSSLDPPMTTQQLENK
IISNSDSFKKRFEKIFIFTHPFNSDKYTKFAHSLLSNLLGNIGYFYGDSIVDRSSIYEYK
EYFQEYNLENNPQVEGPFSLFTATPNKSFFPRGFYWDEGFHLLLIGFWDNDLSLEIIKSW
ISLIDEDGWIAREQILGDEARSKVPKEFVVQYPHYANPPTMMLPLISFLERIKSNSKNQT
DNENPQEDIYSKYIKHPELAIDYLKTIYPLFLRQYNWYRRTQQGEVKGWNRNAFSSEEGY
RWKGCTSTHCFTSGLDDYPRAHPHNGELHLDLLSWMGLFTKTLRLIAEKIGYKKDVEKYI
SIENSIIKNIEDLHWSDEHNAYCDCTISENSNTSIHECHIGYITIFPLITGLLSASSQHF
DRLLDIIYSPDHLWSPYGLRSLSTKDPYFEKDENYWRGAIWININYMVLSSLYKNYINTP
GLYQEKARKIYNELRINLVNTVFHEWERTNFVWEQYNQESGIGQRTKGFTGWTSLIVNIL
SEKY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	567	781	1e-29	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	292	782	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.32e-89	39	248	1	212	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	2.99e-06	581	730	428	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	7.26e-04	647	774	661	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65479.1|GH63	0.0	27	776	30	774
QRD84190.1|GH63	1.09e-270	13	781	14	802
UDD57712.1|GH63	1.09e-270	13	781	14	802
QMW44709.1|GH63	7.55e-269	13	781	14	814
QMW32679.1|GH63	7.55e-269	13	781	14	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.21e-167	26	782	2	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.83e-119	39	784	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	2.66e-232	28	784	31	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.23e-166	29	782	35	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	8.27e-122	39	784	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	9.86e-119	41	784	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.12e-117	39	784	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.077301	0.922647	CS pos: 19-20. Pr: 0.8594

TMHMM  Annotations     

There is no transmembrane helices in KAG4305512.1.