CAZyme Information: KAG4304774.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4304774.1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1501	JABTEG010000006|CGC1	175428.16	6.3990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000006:99719-105067(-)

Full Sequence      

MLGAKSAVFVFILGIFCKISLGSPIINAYLTSSFEAPPFVSVFLETVAAQKESLFFPLLD
IISKKKQILSEFNSDNYHYLRNLVYDSKILTDNVSLSILDYELALQSSAPKVHTYYRYYN
DTVISEMISRNFTLECKNWILVNERQYCSIDEFSKLGNIENEDTKSTKLLSFDHVFYNGK
NNNPVLAVLYADLSSDDYAVYHSFLYEKAKLGNLKYIFRHKPGTFYSTPLYLSGYGVQAS
LKKTDYLVIDDRKIVEDVYEKTPLESYSSNRGSNSFLPDIQGDEIKSLTNTELKELGLSV
AQFVMQSETPLETLNLVLQDFPKYASYLSTIKISKKNLKKMASNYKYLGPEKTMFFINGL
QVDPYKINGFSLLKYLKKEHDLVSSLQKLGLTLKQAKSLITNGDVSNLFNTFLNTRFDFR
DSYEGGKNIIWLNDIENDPNYMHFSNDIYHYFNDLPNEQLHMVRRNLHHVIIPLDFSKKI
DLSMFKDIFLFIQNLLPIRFGIFPILKDPKDIPLIKIFYHLFNTYGIESAIEYMLYLEPN
LRHNKTVLSRNYRYIVFKYDLDLNLKEINIDNIIRSEKIEQYILGAKKWSSRLNIENDDF
LIVNGKFIKKNQNWGTLAFEIFMNDVNIIKEKIIKKSLTNDVNILDYLLEDSVYERNVYI
YPSNKMIRSKKLIDYVYSDENLKFSSINENLNTELSFWLIADFDTKKGLEFMKSSLKYMI
EYPYTSLRFLHNPKLNNENKFNNFSLFLFLLNERNINVTESILNYIETLLNNYNDFKEIK
YPYFILDMYNSSEFLLNSIKAKLYWENMRNLLDKLEFSPGEFGLLANGYVIGPLPESCDF
VFDDFKSLGNFYNISIISPLKTIFKKLKIKVPRYKTFFPVLSSIILSNIISEKHDSSYSS
FSGRDKIYDLARKLTPSFTLGDQKKSIFEVKVILDPLNEISQKLVPILSVLEQIHGVYLE
VYLNPLQEVSKLSINRFYRYVLNPSLKFDNNGNLIYPNAVFEGLPASHLYTIDYDFLESW
IVTQKESIYDLDNLLLSDLSSRGVKKVRAIYELKYILIEGYAEEINSQNVPAGVQLFLKT
KKDNFVTDTIIMNNFGYFQFKANPGIFKIDIVNNKDNDIFEISKIHDSFGSNNNKFSEEI
ILESFEGVTIFPKFIKNSKKEKNRILKESNDFNNNLEFNSIISDNILSQQIEEPIFNTSI
RKSHAEINIFSIASGHLYERFLYIMILSVLKHTKHTVKIWFIENFLSSSFKNLLPYVADE
LGFEYELITYRWPHWLNSQKEKQRQIWAYKILFLDVLFPLDLNNIIFVDADQIVRTDLKE
LVDMDLKGAPYGYTPMCDSRKEMDDYSALYVVDLEKFRKIAAGDILRQHYQILSQDPESL
SNLDQDLPNNLQNIIPIFSLPQNWLWCRTWCSDESLKDAKTIDLCNNPMTKESKLERARS
QIPEWNEYDKTIEDLISRILKQRKNKTNESYTDNIAIPIDMIQNTQFNSDKKNKQNIRDE
L

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1207	1435	5.4e-107	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.81e-176	1207	1455	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.75e-144	1207	1435	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	3.24e-50	1207	1428	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	7.49e-46	417	660	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	7.51e-44	36	222	1	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64450.1|GT24	0.0	11	1501	16	1355
QDS71787.1|GT24	9.92e-300	23	1486	28	1493
APA14047.1|GT24	4.29e-287	23	1464	28	1458
QSZ31337.1|GT24	2.75e-284	24	1464	30	1457
QKX56539.1|GT24	5.47e-281	20	1459	23	1462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	6.86e-266	23	1463	8	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.67e-265	23	1463	8	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	5.28e-265	23	1463	8	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	8.87e-229	23	1397	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	4.43e-208	23	1463	8	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.06e-236	26	1475	22	1448	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	6.94e-190	26	1464	35	1507	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	4.50e-183	12	1464	33	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	2.02e-180	26	1470	30	1522	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.11e-178	23	1455	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007810	0.992125	CS pos: 22-23. Pr: 0.9573

TMHMM  Annotations     

Start	End
7	29