CAZyme Information: KAG4304493.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4304493.1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1044	JABTEG010000008|CGC2	119975.44	8.5217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000008:176447-180604(+)

Full Sequence      

MPYNIAMVSDFFFPQPGGIESHIYQLSQKLLDRGHKVIIITHAYNNRTGIRYLCNGVKAY
YVPFFRESTFPLIYSFFPLFRNIVIREEIDIIHGHASLSSFCHEAILHARTMGIRTCFTD
HSLFGFADAVSIFTNKLLKFTLSDIDHVICVSHTCKENTVLRAALDPHMVSVIPNAIVAE
NFRPDPSKASQDTITIVVVSRLFYNKGIDLLIATIPRICSLYSNVKFIIAGSGPKAIDIE
QMREKNMLQDRVEMLGSIRHEDVRDVMVRGHIYLHPSLTEAFGTVLVEAASCGLYVVCTR
VGGVPEVLPPHMTIFSEPEEDDLVSATSRAINALKEKRIRTDSFHNEIKTMYSWSDVAER
TERVYDRICSTDIHPLIDRLKKYYGCGRWAGKLFCFLVATDYLLLFVLRWILPDAMPITL
PLLHNGYKKQNTTLCSCNACKEQEKVLRECRKRTIKNPRISKKVVFVCIGWFLVIYILHK
ISSIKVNHKIWDPYEILGISMDSSEKEIRKRYKKLSLKLHPDKVQINGTQTRESVESFTY
LQTSLTDEDIRRNYIEYGHPDGKQDFSIGIALPKWIVETKNNYYVLGVYAIAFGFALPYY
VGKWWYGNKLYTKDGIHTKSAERFFKEIEEIMTPKKLELLISQSQEYKFLTGFENELENI
EKKILSKDSKYKLHTQKDLSYRKAYLLFYAHFHRINLKSFKLKKEQISLLQLALVLQSGL
LSICLVYGFLQPILYIMELSQVIVQAIPFNGSPLLQLPCISKKIAKEIVKKVGHPITVQQ
FLEIPEEKRRALLSSYTDDEYSLIINVASKIPVLDIVYSSFKVPGSNFIPPDSIVQFIFK
ARCIFLGEDVQEIIKSDIENETDDDEIDFLLKRKKTKNSQAPSVPYAHVPFYPTKHRPKW
WVFVVDIKQDRIVVPPISITNIDKHVRTFRVSFQAPSQTGSYTFQVQVKSDTYIGTDIKK
NIEFKVEENIVLKNASSNASNIIHKKKFLRNQIKNLSDLQETNKNDSQDTSSYDNDTSDD
SSLDDDYESHSVYNSSTTDSDTTS

Enzyme Prediction     

EC	2.4.1.198:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	331	1.9e-34	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340827	GT4_PIG-A-like	0.0	4	398	1	398	phosphatidylinositol N-acetylglucosaminyltransferase subunit A and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder.
227694	SEC63	9.49e-100	406	978	17	559	Preprotein translocase subunit Sec63 [Intracellular trafficking, secretion, and vesicular transport].
340831	GT4_PimA-like	1.22e-62	4	365	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
400541	PIGA	1.38e-48	42	128	1	90	PIGA (GPI anchor biosynthesis). This domain is found on phosphatidylinositol n-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with disease the paroxysmal nocturnal haemoglobinuria.
223515	RfaB	1.48e-46	4	370	2	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL66445.1|GT4	5.51e-258	7	414	1	393
QRD88033.1|GT4	3.02e-221	1	415	1	446
QMW25931.1|GT4	3.02e-221	1	415	1	446
QMW38012.1|GT4	3.02e-221	1	415	1	446
UCK58425.1|GT4	3.02e-221	1	415	1	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KAK_D	1.17e-102	416	968	43	640	Chain D, Protein transport protein Sec63 [Thermomyces lanuginosus],7KAL_D Chain D, Protein transport protein Sec63 [Thermomyces lanuginosus],7KAM_D Chain D, Protein transport protein Sec63 [Thermomyces lanuginosus],7KAN_D Chain D, Protein transport protein Sec63 [Thermomyces lanuginosus]
7KAH_D	1.77e-54	452	968	79	611	Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae S288C],7KAO_D Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae S288C]
6N3Q_D	1.80e-54	452	968	80	612	Cryo-EM structure of the yeast Sec complex [Saccharomyces cerevisiae S288C],7AFT_D Cryo-EM structure of the signal sequence-engaged post-translational Sec translocon [Saccharomyces cerevisiae S288C]
6ND1_A	2.23e-54	452	968	80	612	CryoEM structure of the Sec Complex from yeast [Saccharomyces cerevisiae]
7KAI_D	2.85e-54	452	968	94	626	Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae BY4741],7KAJ_D Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae BY4741],7KAP_D Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae BY4741],7KAQ_D Chain D, Protein translocation protein SEC63 [Saccharomyces cerevisiae BY4741]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87172|GPI3_SCHPO	9.87e-219	7	413	1	410	Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi3 PE=3 SV=1
sp|P32363|GPI3_YEAST	4.10e-157	1	413	1	427	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT14 PE=1 SV=4
sp|B5VSZ6|GPI3_YEAS6	4.10e-157	1	413	1	427	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=SPT14 PE=3 SV=2
sp|A6ZW78|GPI3_YEAS7	4.10e-157	1	413	1	427	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=SPT14 PE=3 SV=1
sp|B3LKQ3|GPI3_YEAS1	4.10e-157	1	413	1	427	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=SPT14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
389	411
460	479
585	607
707	729