CAZyme Information: KAG4304122.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4304122.1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1145	JABTEG010000011|CGC2	132102.96	6.8751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000011:76820-81143(-)

Full Sequence      

MYPGLMITSYIIHSFFHFLNYPINIRDICVFFAPAFSSLTALATYFLTKELKDETAGLFS
AAFIAIVPGYISRSVSGSYDNEAIAITLLVTTFFSWIKAVKTGRAFWGSLTAFFYFYMVS
SWGGYVFITNIIPLHCFFLILMGRFSSKLYVAYSSFYSLGTLMSMQIPFVGFQPIRTSEH
MAALGIFGLMQILAFVNFVRFHTSDEKFKTLLKYSVFFVFFFSFAVLVLLTITGTIAPWT
GRFYSLWDTNYARIHIPIIASVSEHQPTSWAYFYFDFGLLIWLFPAGVYLCFQKLQDEHV
FVIIYAVMASYFSGVMVRLILVLAPIVCIASGLILSEFLDKYLFFSDFKVSPTSSESKIH
ESIMAYKKSLKDTGKAKLPVLNSIKGSTKNIAHKIIRSWISKLASVSLLFYYLVLFVYHS
TWVTSGAYSSPSVVLSGQTSSGKELIIDDYREAYYWLRKNTPYDAKIMSWWDYGYQIGGL
ADRITLVDNNTWNNTHIATVGKIMSSSEEISYPILRKHDVDYILVIFGGLLGYSGDDINK
FLWMIRIAEGVWPNEVNENSFYSHNGYRVDKDATPTMKNSLMYKMSYYNFNKLFNGNDAY
DSVRGQHIPVNDISLNILEEAYTTENWLVRIYKVKSPDNLGRDHIKKKSSIPHKNTKGDM
YLENIREIPEDYEEESTSDSEDQEYPVNHMKHDVDSWQIYNEKTKEMVHVEPTFGSAMKK
KALEIDHAFSLISHWTQDLAYDFNCDNIYSEKHLKKMIMEHKEIDFKESVFFEDRNKEIM
ENIEKAILKEDEEERERIRKDIEEKQRQKILDENKKIQEKQNNESTEVLEGMTHFEEKMK
NYEEKTCIDEKKIIDEKKTNTIITTDIVQFPVLESKRKDYIYDAMDRDIKLNVLKPVSEN
EVWRKFCFQNKRKITPKCGQLTNSKQQIARIVKDLEEIIIMSKEVAMTAIIKQAETEVTV
NLYSAYPLAAVCVLLMSNHPDFVDILLSRFAKKCPYTIPYLKYNKNTEEGKKALGFYRFK
NGNFEEEASYTERQCGIFAVFAAIMQTQHSPNYLPMNFGWTLLAKLLNEPPPSETVFAII
STFIDVAGNAFTKHYGLQADKLIRLAVNDWVGDNKGSNAARLRILGEEWVNQGKIGLKNG
GVFEE

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	3	701	1.6e-164	0.8484848484848485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	3.14e-118	2	429	75	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.30e-94	2	642	91	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
400257	GLE1	5.14e-74	898	1103	1	231	GLE1-like protein. The members of this family are sequences that are similar to the human protein GLE1. This protein is localized at the nuclear pore complexes and functions in poly(A)+ RNA export to the cytoplasm.
275016	archaeo_STT3	8.91e-31	25	525	94	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
224720	ArnT	0.002	31	290	88	338	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65471.1|GT66	0.0	1	649	92	743
QRC97875.1|GT66	1.47e-283	1	644	92	725
EGX52786.1|GT66	9.86e-283	1	644	84	713
UDD65301.1|GT66	1.17e-282	1	644	92	715
QMW36082.1|GT66	1.65e-282	1	644	92	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	5.10e-253	1	642	86	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	1.09e-226	1	639	142	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.35e-225	1	641	88	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	1.90e-225	1	641	88	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	1.24e-223	1	635	88	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	1.51e-269	1	643	94	724	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	2.62e-252	1	642	86	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q3TDQ1|STT3B_MOUSE	1.28e-226	1	639	139	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	1.41e-226	1	639	142	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	5.58e-226	1	639	142	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000000

TMHMM  Annotations     

Start	End
270	292
299	316
320	339
403	425
4	21
28	45
55	77
84	106
121	143
150	172
182	201
214	236