CAZyme Information: KAG4303803.1

Basic Information

• Species: Pneumocystis oryctolagi
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis oryctolagi
• CAZyme ID: KAG4303803.1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		45626.64	9.5137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryctolagiCS1	2856	N/A	0	2856

• Gene Location: location=JABTEG010000023:30190-31501(-)

Full Sequence      

MELIDLLILIISFLGYKTIFIFICVLSSFLNVYDTSALLLLRKPKNLFQKIIVSFVRWDN
IYFIALAHRGLLFEQEWAFGPGFPYIVRLFTDWIFVSKSLYNYAFISILLSHLFHLCSIF
SLYYLTFKIYQSRDMAIVTSFLYLISPSGIFLSAGYTETALSWCIASIIRSNGLLLSVFF
LYPTFMYIYQILRYPEFGLCLKMIKFGIYSLIVCAGFFWVQYCAYIEFCWPEKKRDWCFK
KIPFIYSFVQSYYWNVGFFKYFKVSQIPNFALAFPAILISIKSGIHYFLKNNKFRKITRN
LDLYYITQLLLTVVCICVMHVQIFTRMISCLPGIYWWLADCLLNDRLYSCSNKFSLKKKK
SLYWVKIWILYGTVQAVLFGTFLPPA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	18	386	1.9e-89	0.9754299754299754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.33e-32	46	386	48	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.14e-20	12	386	25	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65897.1|GT76	7.22e-118	1	386	1	302
CAA90590.2|GT76	1.53e-53	12	386	76	464
UPK97415.1|GT76	7.15e-50	12	386	17	420
QPC72356.1|GT76	2.29e-47	13	386	18	423
UNI18119.1|GT76	2.88e-47	33	386	38	434

PDB Hits     

KAG4303803.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09712|GPI18_SCHPO	2.72e-54	12	386	76	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q4I0K3|GPI18_GIBZE	7.93e-48	33	386	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	8.24e-43	12	386	25	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.24e-39	53	386	76	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.51e-39	33	386	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999887	0.000113

TMHMM  Annotations     

Start	End
7	29
77	96
103	125
135	157
169	191
206	228
267	289
304	321
362	384