CAZyme Information: KAG2023453.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2023453.1
• CAZy Family: PL3
• CAZyme Description: chondroitin AC lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	JAAGWA010000001|CGC3	90088.82	7.8542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000001:2599181-2602237(-)

Full Sequence      

MMRFGSAVALSGCLLSMLLIFSSLLLPSEFPSRSLSGWLAAVKGRGAFDYLLRHGSGPSP
MQYRSASKITRQVSEDLSVLHQRRVSLIVGQLRNPSNISHWLDSLDNLTGKWPDTEVDYT
TGCGARRANWPAQAHWQRILVMSGAWHGGYRGAEQWVKDERLRTTIGRAMEYWFSRDITN
VDCLDWGGTPRCPCDNVDDSLWNTNWFSNIILIPRLAGQSCLLLSDSLTLREREVCSNIT
RRSFGTFGIKLNQVGYLTGANTLDVARVGIDCGLLNSNISMIADAYRRIHDELVIQNVTK
VDGIRADGSFAQHAGVLYNGNYGKDYSNAVLDVEVIAAGTSFSADTTAQTAFETLFDGHR
WMIFSNTLSQVLHFDFSVLGRFITFPVIDDQATGSIQINLTKTWELGRLWSSPSLTTFGE
SLMQNFSSANAGGLTGTRMFFANDYMVHRGPNFFSSLKMYSSRTLNTECINSQNPLGFHL
SDGTLYTYLRGNEYTDISAAWDWDLIPGTTVDYRNTLLHCSGATVTGRESFVGGLSDGKT
GIAAMRYTNPTTRSLRWQKTWFFLNDGAQHVVINILASSSGAPVYSVLDQKRRNGLTVVD
RREVLNSSTITGPQRLWHDNVGYAFRSLTNATTPLHVRMGERTGSWSAIGTSTQPPVSVD
MWAGLLEHIDLSQPLEYTILPGTSYPDFLQRTELPRVETIANNDNVTAIYDQRTGIAMVV
FWNNGESSIAIDTRTPIAQMTITSTANVIVMFSTKNGTVLVSDPTQMLDTVVLKFTIGRG
KRPLYWKGQAEKSLVFQLPGGGRRGDSVSGTIR

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	440	663	7.9e-48	0.9176954732510288

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	1.73e-90	437	684	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	1.14e-85	129	764	60	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	4.62e-17	101	383	32	284	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	5.84e-12	700	771	1	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96784.1|PL8_4	7.00e-232	74	812	91	818
QRW05711.1|PL8_4	7.87e-200	74	809	23	779
QRV91644.1|PL8_4	1.57e-199	74	809	23	779
QRV76817.1|PL8_4	6.26e-199	74	809	23	779
QRW05704.1|PL8_4	5.21e-196	74	809	20	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WCO_A	7.16e-26	205	766	139	713	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	8.78e-25	205	766	139	713	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
1F1S_A	3.74e-15	259	729	257	775	Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution. [Streptococcus agalactiae],1I8Q_A Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan [Streptococcus agalactiae],1LXM_A Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan [Streptococcus agalactiae]
1N7O_A	1.35e-14	153	730	87	679	Chain A, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	1.36e-14	153	730	87	679	Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53591|HYSA_STRA3	3.17e-15	203	729	368	945	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
sp|Q54873|HYSA_STRPN	1.71e-14	153	730	373	965	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000060

TMHMM  Annotations     

Start	End
7	26