CAZyme Information: KAG2023315.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2023315.1
• CAZy Family: PL14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		45853.45	9.7599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000001:2354604-2356156(+)

Full Sequence      

MFPPFLVILASLWVPHTVFGDGNDWVNVDYVLEEAHQAATSSDSPTYQAVNSIVRGADRL
LRKGPWAVASDKGFLPPSKDARDYLSWAPYHWPDCRWCSKSGRNQLAHTGEGSTNASSTA
FDSPDPSDFPDDDMLYEESVDSEERGLRDLHLAYHRGALQLHKRSHNRRAQSAFNLVDVS
VPTNVVSSLVASITVPAVPINPVGTSSTDSTTSKGTRPPAQAAAKTTKTTCTPSPTTSMA
PSATWTTCRYIGRDGKVNPDVRGLNGPSAINSLSQYVLYGCISAVVNKDSKHAKEAVAAV
DRFFLSPSTGMNPNLKYGQVVRGPGPAGISGTFTGILDLRGTVKIVNGLMLLRELAHPDW
TDKRDSAMRSWLSQYGQWLTHSDIGKMTGSRPNWRLRRFSRGPRKKRYRSLCNSSRNSS

Enzyme Prediction     

No EC number prediction in KAG2023315.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	243	393	1.5e-32	0.5161290322580645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	4.63e-15	248	393	33	167	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW04926.1|PL38	3.03e-44	17	393	18	464
QRW18874.1|PL38	2.65e-41	6	386	7	482
QRV90823.1|PL38	1.37e-34	2	393	9	440
QRW05956.1|PL38	1.63e-32	5	386	6	247
QRW12314.1|PL38	1.63e-32	5	386	6	247

PDB Hits     

KAG2023315.1 has no PDB hit.

Swiss-Prot Hits     

KAG2023315.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999685	CS pos: 20-21. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in KAG2023315.1.