CAZyme Information: KAG2023314.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2023314.1
• CAZy Family: PL14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		52945.84	9.2664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000001:2355167-2356780(+)

Full Sequence      

MLYEESVDSEERGLRDLHLAYHRGALQLHKRSHNRRAQSAFNLVDVSVPTNVVSSLVASI
TVPAVPINPVGTSSTDSTTSKGTRPPAQAAAKTTKTTCTPSPTTSMAPSATWTTCRYIGR
DGKVNPDVRGLNGPSAINSLSQYVLYGCISAVVNKDSKHAKEAVAAVDRFFLSPSTGMNP
NLKYGQVVRGPGPAGISGTFTGILDLRGTVKIVNGLMLLRELAHPDWTDKRDSAMRSWLS
QYGQWLTHSDIGKMTGSRPNNHGTFYVSQLAAAKIFEGSKEEAISILVQFFKKQFIDQIA
ASGEQPFEAVRTRPYHYRCFNIEALITNAKLGDQLGLDLWSSRSKYGATIQTAMDFIIAS
DPKGEKASEAVPHVAAVAAAYGDPKGKYAAFLKKHLSNYQSKPFWFYDQPRAVSRDSSKK
MVKQSDASGNGQEADHDGASTGTPKSPNIPFTCPDVFKDATRVEIDNGIFVTCDELRPFY
ELPMPI

Enzyme Prediction     

No EC number prediction in KAG2023314.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	110	359	4.8e-64	0.8709677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.03e-47	106	363	19	272	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW04926.1|PL38	1.48e-117	111	480	316	678
QRV90823.1|PL38	6.72e-111	112	480	293	647
QRW18874.1|PL38	1.48e-99	98	480	308	721
QRW19896.1|PL38	9.93e-82	104	405	100	402
QRW05956.1|PL38	1.91e-75	103	410	99	408

PDB Hits     

KAG2023314.1 has no PDB hit.

Swiss-Prot Hits     

KAG2023314.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG2023314.1.