CAZyme Information: KAG2020125.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2020125.1
• CAZy Family: GT15
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		64825.56	4.4126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000002:1276313-1278447(+)

Full Sequence      

MLDQTWLVAIFQVLTLTQTVVGYRWPSPQYDALEGLLYEGRRRDGSNLASIQHPCKNRPG
SRASIGAEWLRLAYHDVATHNIETGTGGLDASIAFELDRAENFGNGMHESIEDFETFPSK
YISRADVIAIGTILGVASCGGPIIPFRGGRIDALSADVAGVPEPHQDLETHTEIFRRQGF
SQEEMIGLVACGHTMGGVRSSDFPDIVPPQDDSERFADFDDTHEFDNDVVVKYIDGTTQN
PLVVHANMTLNSDLRIFESDGNATMRRLASPEDFSSTCGTLLEKMLNVVPSNVVLTEEIT
MLPVKVTDAHLTIENEQLVFKASLRIAQPISAPNKNRLVKIFWCDRYGANKDCENRTGKT
AGVASSPRIDDPQVSPLTFRAGFQFVHYDFIVPIDTEESLSKFWFEVDEKDGTKPKRHDN
DGEGYVLQQDNVIYVPRLSSISFNREDRTQKTYYITAGVKSGASPSRVYMSAFDSATDAF
STIIDEDVDMALNETLPSAAGYTFYSASIESPGTQLTVDLHAVIDGETYTEDYMQTFFVA
GRTPSTKPTNVTIVDIVPPTKDLDSSATANILSLDIIIGLLALSAFIF

Enzyme Prediction     

No EC number prediction in KAG2020125.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	60	221	2.2e-26	0.6470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	2.49e-127	25	287	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	8.21e-27	63	287	15	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.11e-21	64	196	14	152	Peroxidase.
173825	ascorbate_peroxidase	8.89e-19	70	196	34	165	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	2.71e-17	68	241	40	214	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03617.1|AA2	8.35e-76	25	427	26	430
UKZ86986.1|AA0	8.76e-76	23	508	24	514
QBZ57066.1|AA0	2.62e-71	9	513	10	502
VBB76056.1|AA0	1.99e-69	25	541	29	532
QKD59397.1|AA0	7.00e-69	25	434	22	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4GED_A	2.50e-11	47	196	7	162	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	2.56e-11	47	196	7	162	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
5AL9_A	2.56e-11	47	196	7	162	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
3RIV_A	2.59e-11	47	196	8	163	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	2.59e-11	47	196	8	163	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	8.80e-60	9	403	7	394	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	7.34e-16	44	253	6	209	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|P0CP55|CCPR_CRYNB	1.31e-14	64	196	127	264	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CCP1 PE=3 SV=1
sp|P0CP54|CCPR_CRYNJ	1.31e-14	64	196	127	264	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CCP1 PE=3 SV=1
sp|Q8GY91|APX6_ARATH	3.64e-14	70	196	118	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999769	CS pos: 22-23. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in KAG2020125.1.