CAZyme Information: KAG2020048.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2020048.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	JAAGWA010000002|CGC9	82500.97	4.7541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000002:1141899-1144827(-)

Full Sequence      

MVSLNRVFSSLLLLVGLVCALDDLTIYQNDGLTSGWENWSWNTETDFANSELYAGESGTS
LAVKSSEWAALSLKGSATISDYAGLRFDIAGDQPGLQIYFTSTTDDTQSASIVLSDISDS
ITPTEFSTLLIDFKSLPGTGAPLGSGTWDRITFQALSSGASYHLDNVVLVGALVVEPKIL
SAEPIASNTVAVTTQGEVDAAAVRVFHNGRPVRVTSRTSYSPPDTPSKSITYLTLGSPLS
QGNLAVVAGESSFNHTLPRAQSARLDLRRRREIDPHIYGVNWPKNANYIRTLGVTFSRWG
GNAVTAYNPFEHFTNAGSDWFFENRGNEKSDDWIGWIHEAGSDAIMTVPALDWVAKDATS
YSYPRSIYPEQERFNPYNPDSGNGRFPNGTNLSPPTDPNRAYTPWNTTQATTWLSQLKNK
PKFATIDNEIEIAAHTHTDMHPEPMSYDEELDRVTRFALATKEALPDVKVLAPSPCSWWF
YWTSAIGWSDTEAHNNTDFLPWFLQQMRDLEGQHGKRLLDYLDIHYYFQPDTSAEDAAAK
ALRLRMTRSLWDETYIDESWIGSDPQNHQPNPRVVSLIPRFKKMIQDIYPGTKLSVSEWS
ATNENDITGGLVAADALGIFGKYGLDAATYWATPNELGPTGLAYWLYRGYGTVFGSTSVE
IEIPGFNPDILGVYAAIDDKRKFSVVIVNKNPSSAVSLSLAGLPPGRYFLRHFGGEAGIA
KWQTTTTVSSTDYIVVPSYTAVFLLQR

Enzyme Prediction     

No EC number prediction in KAG2020048.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH44	269	698	1.9e-104	0.8657587548638133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403942	Glyco_hydro_44	7.67e-94	314	529	1	233	Glycoside hydrolase family 44. This is a family of bacterial glycoside hydrolases formerly known as cellulase family J, and now known as Cel44A. It is one of the major enzymatic components of the cellulosome of Clostridium thermocellum strain F1 and of many other Firmicutes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA75149.1|GH44	0.0	23	746	19	739
CCA75148.1|GH44	0.0	23	746	19	741
AKJ63894.1|GH44	3.28e-81	271	695	43	479
AUB83159.1|CBM8|GH44	9.53e-76	23	699	38	658
SBT44864.1|CBM2|GH44	3.18e-75	270	733	41	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FW6_A	4.51e-65	270	725	30	499	Crystal structure of CelM2, a bifunctional glucanase-xylanase protein from a metagenome library [uncultured bacterium]
3II1_A	4.61e-65	270	725	30	499	Structural characterization of difunctional glucanase-xylanse CelM2 [uncultured bacterium]
2E0P_A	1.42e-47	270	691	20	454	Chain A, Endoglucanase [Acetivibrio thermocellus],2E4T_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EO7_A Chain A, Endoglucanase [Acetivibrio thermocellus]
2EEX_A	3.62e-47	270	691	20	454	Chain A, Endoglucanase [Acetivibrio thermocellus],2EJ1_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EQD_A Chain A, Endoglucanase [Acetivibrio thermocellus]
3IK2_A	1.51e-41	273	745	16	508	Crystal Structure of a Glycoside Hydrolase Family 44 Endoglucanase produced by Clostridium acetobutylium ATCC 824 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29719|GUNA_PAELA	5.11e-43	270	691	46	481	Endoglucanase A OS=Paenibacillus lautus OX=1401 GN=celA PE=3 SV=1
sp|P22533|MANB_CALSA	2.60e-37	270	691	798	1242	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999795	CS pos: 20-21. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in KAG2020048.1.