CAZyme Information: KAG2019903.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2019903.1
• CAZy Family: GH92
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		66410.56	4.3663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000002:856737-858751(+)

Full Sequence      

MRLQLSTTTTLAVLLSTFSTLSSAYTWPSPQYDALEALIYEGRTTAGSSLTALVHPCKKR
VGTLASVPAEWLRFAFHDMATHNVDDGTGGMDGSIVYELGRAENFGSGFNQTLGDFENFP
NKYLSRADIIAAGAVHSVATCGGPIIPFRGGRIDTFEAGGFGTPEPHHDLDTLTESFRRQ
GFSTPEMIKMVACGHTMGGVRSEEFPQLVPPGPDPSVMVIQDFDTTPDFDNKVVTEYLDG
TTPNVLVNSPNRTLVSDLRVFSADGNNTMREIAPEDTFQSECRDILERMLNVVPRGVTLT
EEITMLPVKVKNAQLTIEKEQLVFKSTLRLAQPLDEPVSKERVVTMFWCDRYGNNKDCED
SARSSVFVKRLTEDPDISPVTKNLGYSFYSYDFVVPINPAQSISKFWFEVDEKDGSRPTL
HNNEGTDYPVEQDEIIFVPMMSSVNVISNGTDGKVVQNRNNLTGEFFYREYNLVVGVRED
TEPDRVYVDGFDSSVLGFAYLVNTTIDLTLDDSLKPVAGYKFYTGQLDDSGLQLSIDLNL
DVGGRTYRQDFVQTNVLDNTPYVAPGTVMSGDRPSSALALRDGWICSLVALSLSMVAVGY
LS

Enzyme Prediction     

No EC number prediction in KAG2019903.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	69	241	9.1e-24	0.6509803921568628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	8.11e-164	27	291	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	9.84e-24	69	291	19	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.31e-21	58	203	6	157	Peroxidase.
173826	ligninase	3.89e-17	70	244	40	213	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	1.88e-14	72	198	34	165	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57066.1|AA0	1.43e-73	12	458	13	450
VBB76056.1|AA0	1.62e-70	26	572	28	545
QYT03617.1|AA2	1.58e-67	27	460	26	457
QGA18666.1|AA5_1	1.39e-65	16	450	14	436
QRV94524.1|AA2	2.29e-65	11	560	5	531

PDB Hits     

KAG2019903.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	3.40e-61	26	406	22	394	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	5.07e-14	72	198	118	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q7XZP5|APX5_ARATH	2.39e-12	72	257	34	209	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q6BKY9|CCPR_DEBHA	9.14e-09	73	213	114	260	Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=CCP1 PE=3 SV=1
sp|P0CP54|CCPR_CRYNJ	9.89e-09	62	198	126	264	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999701	CS pos: 24-25. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in KAG2019903.1.