CAZyme Information: KAG2019603.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2019603.1
• CAZy Family: GH79
• CAZyme Description: cellobiohydrolase II-I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		44808.97	4.4535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000002:71676-73105(-)

Full Sequence      

MKYLNLLAALFAVAPLTLAAPSASFERRQDSSVNPYIGKSPLVIKTYGEKLEETVRYFEE
QGDELNAARTRTVQGVPTFAWISDSASIDSIPPLIADALAQQEETGEKVIVQIVIYNLPD
RDCSAKASDGEFHLDDDGFNKYKAYVNRIAEELSTEDADKLHFAIILEPDSLGNLVTNMH
VEKCRGAEAAYKEGIAYTISSLQKPNIDLYLDAAHGGWLGWNDNLRPSAEIYREVLDLAR
EITPGARVRGLATNVSNYNPYKTQAREPYTEWNNSYDEWNYVKNLVPHLEAVGFPAHFIV
DQGRSGKGGIRTSWSQWCNIRGAGFGIRPTSDPQVLDSENVDAIVWVKPGGESDGTSDVD
AKRFDENCRSEVAHVPAPEAGQWFNDFVVNLVLNANPPLEPLEL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	56	358	1e-87	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.02e-141	63	363	1	293	Glycosyl hydrolases family 6.
227616	CelA1	3.03e-49	17	399	10	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAH08705.1|GH6	3.86e-299	1	404	1	404
BAH08704.1|GH6|3.2.1.91	1.85e-251	1	401	1	400
BAH08703.1|GH6|3.2.1.91	5.20e-218	1	401	1	398
BAH08706.1|GH6	1.72e-202	1	401	1	397
CBX92025.1|GH6	8.11e-120	11	401	7	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A64_A	1.08e-242	20	401	1	381	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	1.78e-241	20	401	1	381	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	5.12e-118	31	399	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	8.28e-117	31	399	5	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
1BVW_A	1.91e-101	63	398	29	359	Cellobiohydrolase Ii (Cel6a) From Humicola Insolens [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	3.61e-110	34	397	64	409	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|P49075|GUX3_AGABI	2.62e-109	34	399	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	6.86e-96	63	398	145	475	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	1.09e-94	9	399	3	364	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|A2QYR9|CBHC_ASPNC	7.41e-94	22	397	88	457	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999747	CS pos: 28-29. Pr: 0.6930

TMHMM  Annotations     

There is no transmembrane helices in KAG2019603.1.