CAZyme Information: KAG2017448.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2017448.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		46305.64	6.3624

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000003:553978-555618(-)

Full Sequence      

MLRSSISNAIAGLVGAALITGAYAQTPEFQGELLLQPQPNNAKCLTASSNSDGAPVVIAT
CVAGGSPSQKWVFSGGTVRVHGNKCLDVTDGVDQDGTKLQIWTCSATGNSNQQWYYSKWD
NTLAWTGKGKCVDLTDGNLADGNQVQIWGCWNKNPNQVWSTGYLPTDLPNKSQNGQYGTN
NCGTGSSQSSNCQTAWINSATDFCLYGPPSLGTIGDTERFAVSYCTKSGRGTRTIPDGTL
QGVHFVRTPEYVQITGVGDFTKMNIPFGDDGGEMDNRGADGKGNPIGGLLFGNTFGSGLQ
YHEWTQFISYREFCIRACIGPRSKQLCNHIYDIMGCWWNIPANYSPGVYEECQGDPAIPM
GVYGTSTWYQGVSPTPPPHPAPASSSCSTLSTVGVTPLRRSLPRRDVPLEGGHVLRDYVE
PHIPRATSPPM

Enzyme Prediction     

No EC number prediction in KAG2017448.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	40	165	8.3e-21	0.6595744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.84e-23	40	159	9	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	7.61e-21	35	161	3	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411518	lectin_1	1.20e-15	20	161	690	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	2.49e-14	76	174	3	97	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.15e-13	40	159	5	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA67406.1|CBM13	1.95e-137	24	393	17	386
CCA67412.1|CBM13	4.03e-135	16	395	10	387
QRV92416.1|CBM13	2.01e-133	10	410	4	401
QRV77601.1|CBM13	8.09e-133	10	410	4	401
QRW06545.1|CBM13	8.09e-133	10	410	4	401

PDB Hits     

KAG2017448.1 has no PDB hit.

Swiss-Prot Hits     

KAG2017448.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000348	0.999655	CS pos: 24-25. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in KAG2017448.1.