CAZyme Information: KAG2017438.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2017438.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		45547.95	5.7876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000003:531051-532603(-)

Full Sequence      

MLSKAFTTLASLAALAVVAQAQTPEYIGQLLLRSAINDNKCLTATADHDAAPVVIQPCTG
APSQKWTFTEGTVRVFHNKCLDVIDGADRDGTKLQIYTCAPHNPNQHWYYNKWENKLEWN
GRGKCVELPDANTADGTQAHIWGCWKTPKQTWNTGYMPNDLPRQSQHGQFGTNQCHGGED
SNCQTSWINSATDFCLWAPPTLGTVGALEREVVAYCTKSGRGARTIPDGTLTGVHFVKTP
DYVQITGTGDFTKLNIPAGDWGGELDNKGGDAKGNPIGGLIFGNSFADGLQYNEWTEFIS
DKEFCIRACTGPRAKELCNHIYDTMGCWWNMPANYDSGVFEECEGDSATPMGVYDGTSTW
YQGVSPTPSAHPAPASSNCVSLPTVGVSPLLKKRGVEGVPGFNKKVSVPEFPGATPAPVA
R

Enzyme Prediction     

No EC number prediction in KAG2017438.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	35	155	1.8e-21	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	1.54e-19	32	154	3	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.73e-19	37	152	9	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	2.40e-16	33	154	1	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	6.81e-12	32	154	714	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
404972	RicinB_lectin_2	3.07e-10	62	142	1	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA67406.1|CBM13	5.13e-145	8	385	5	386
QRV77601.1|CBM13	4.09e-143	9	390	4	389
QRW06545.1|CBM13	4.09e-143	9	390	4	389
QRV92416.1|CBM13	1.16e-142	9	390	4	389
CCA67412.1|CBM13	6.09e-137	10	387	7	387

PDB Hits     

KAG2017438.1 has no PDB hit.

Swiss-Prot Hits     

KAG2017438.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999736	CS pos: 21-22. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in KAG2017438.1.