CAZyme Information: KAG2016492.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2016492.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	JAAGWA010000004|CGC7	25349.87	7.2419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000004:3389602-3390372(+)

Full Sequence      

MRSLLQLAAVVACVLPNALAFTGKTCRIMPLGASITFGVGSSQGNGYRDDLYNLLARDGN
TVNMVGNNPATGSTFHDKDTEGWPGLIIDEVFCKMRESMPRNRPNIATILVGTNDMTRNI
DVINAPSRLSHLIGGVLNFPPQTLVVVSSLPPNRDAAANARINAFNAAIPGVVQHWVNQG
RSVVFADCGRLVSVNELPDGTHPNDAAYERIGRCFYDAIVGADSRGWIWPVQGPPP

Enzyme Prediction     

No EC number prediction in KAG2016492.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	27	219	3.4e-52	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	9.28e-48	27	219	2	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	2.06e-16	31	218	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	6.29e-14	31	210	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	1.68e-05	31	219	14	208	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238874	FeeA_FeeB_like	1.71e-05	97	220	61	190	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCF09554.1|CE3	1.08e-45	19	236	66	278
BCL13691.1|CE3	7.92e-45	17	236	64	278
QPG99528.1|CE3	8.38e-45	27	235	46	255
ANS70507.1|CBM13|CE3	1.40e-42	27	228	36	234
QZZ25192.1|CBM13|CE3	1.39e-41	27	228	32	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	7.09e-24	24	220	4	196	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]
5B5L_A	3.28e-08	77	204	54	184	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
5B5S_A	3.28e-08	77	204	54	184	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	6.03e-12	15	221	31	262	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999726	CS pos: 20-21. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in KAG2016492.1.