CAZyme Information: KAG2016308.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2016308.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		66835.71	4.2269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000004:2984766-2987240(+)

Full Sequence      

MPNPQPLSPPPGQPQRTGVPGGFELIGESLVSAQQLFLGTEDKVLFVDKVEANPAQINGH
PAWASEWAVGSGEQRPMDIVTNSFCAGGNVLGNGTWINVGGNEAVTFGGIPTPDQNTASA
PYFNVDGRTSIRLYTPCDDGNCDWTLSPIPTDQRWYPTLETLDDGSIIIIGGCRYGGYVN
DPGQDNPTYQFFPPRGEGTVYLDLLSRTLPANLFPLTWLLPSGKLLIQSNWATSLLDYNT
NEETPLDDIPDAVRVYPASAGSIMLPLTPANDYTATILFCGGSNVQTERWTAPDFIKPSY
GASTSCVKITPDVSPSYSQEDPLPEARVMVNMVFLPDGKILTLNGARFGTAGYGNDTWAI
GHSYADNPLYTPVIFDPEATTGNKWSDEGLAASTVPRMYHSSAVLLPDGSVMVSGSNPNP
DFVAPSDGHPFPTEYRTELWYPTWYKERRPEPKGLLSSLSYGGDSFDITLDEDDLFGDVN
NVKTAKVTIVRPGFSTHNLNMGQRFVQLDHTYTGYGSNNSAVLHVSQLPPNPAVLAPGPA
LIFVVVNGVPSVGKMIMVGNGQIGPQPVHDAAQLAPSELIGVKNTGAGGGTKGNGGGDDD
DAGAAVTKTASVVGMVAALVGSFIASLW

Enzyme Prediction     

No EC number prediction in KAG2016308.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	19	576	2.2e-225	0.9822380106571936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.83e-38	69	282	53	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	1.33e-27	457	558	4	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	4.82e-22	444	558	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15307.1|AA5_1	2.23e-253	9	623	31	639
QRV86752.1|AA5_1	3.16e-253	9	623	31	639
QRW00801.1|AA5_1	9.34e-253	9	623	31	640
QRW26896.1|AA5_1	1.60e-246	9	585	31	605
QRW07636.1|AA5_1	1.61e-239	9	592	32	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	2.55e-16	152	514	255	576	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	1.25e-14	152	514	244	565	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.26e-14	152	514	249	570	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2WQ8_A	8.07e-12	48	558	214	659	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
1T2X_A	1.04e-11	84	558	227	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	5.11e-82	30	565	37	556	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	3.66e-54	75	558	87	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	2.48e-52	55	558	147	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.96e-42	75	567	475	914	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	6.57e-35	31	558	79	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KAG2016308.1.