CAZyme Information: KAG2013548.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2013548.1
• CAZy Family: GH18
• CAZyme Description: MIPC synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496	JAAGWA010000005|CGC10	56387.10	6.7889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000005:1559279-1560825(-)

Full Sequence      

MNTRRAIHVFLAVLALFLLGTVIVLSSVTFYLAIDPAAYLDELDLYQSPGPDNSNTNASA
HRIPKIIHQTWKTDTLPPRWQPISQACRDMMPDYEYMLWTDDSSREFIAQNYPWFLETFD
SYEYPIQRADAIRYFVLHHYGGVYMDLDIGCLRPMDPLLNYPVILPKTIPVGVSNDLMFA
EKGHPFLLQTINNLVTFDHSWVLNYPTVMFSTGPMFLSAQYGIYTTAHPDSATKDIRILP
KSLYGKNARPEEAPHSFFSHFYGSSWHADDAAFIGFLGTWGKVLMWVGLIVLVIGVVRLP
NKAQRRGLRRISGYDIHFPRLSRSGRWYLPLGRFSSPPSPVSTSSSSESIRLSDSDEVDI
LHLPLSIRPPSPTTSDLEPYAGRNSPIVDAFRRMRNRVTSIATSDPHDQAPMTPIRPRRH
RGILFFLPAIFTPSMSRSPQDIEMEPSTPPPAYSMPSHRHHRSDDKHPNIEDDEPHDSLL
HPAVLEDSSSSRERDL

Enzyme Prediction     

No EC number prediction in KAG2013548.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	160	2e-24	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.02e-56	47	275	66	289	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.14e-28	77	159	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO95196.1|GT32	2.49e-153	1	432	1	420
CCA69953.1|GT32	6.33e-152	4	449	3	475
QRV73076.1|GT32	3.53e-145	4	438	3	380
QRW02122.1|GT32	3.53e-145	4	438	3	380
QRV87945.1|GT32	3.53e-145	4	438	3	380

PDB Hits     

KAG2013548.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.16e-73	56	344	51	316	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	3.42e-69	53	271	45	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.55e-68	36	287	37	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	6.66e-67	63	274	62	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.88e-62	52	274	71	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996677	0.003342

TMHMM  Annotations     

Start	End
7	29
283	300