CAZyme Information: KAG2012243.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2012243.1
• CAZy Family: GH16
• CAZyme Description: aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695		74184.94	4.3705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000006:2595461-2597864(-)

Full Sequence      

MLSLELLVLTLTALTAPVLAHRDYNNVHARRFGLTPRDYITPETRLESYDYIIAGGGLAG
LVLASKLSADGETTVLVLEAGGTGDEQRETIDRPGLTYFRSLLNTEHDYAYKTTPQDGAG
GRIMNWPRGKILGGSSAVNGMYLVRPNALEVNAMHEMNADNDAKEYADAWTWDSLLEAMK
QGETFTPPTQEALDVAGMRFNPDSHGSSGPLQATYSAYMVPISSAWLPTLEAAGVPISND
AYSGDNVGGFFSIMAINPSNWTRSYAKSAYIDNLPPRSNLHILTNSAVTRILFADNAQDG
LQVASGVEFASDANDTPKTVLANKEVILAGGAVGSPHMLLVSGVGDRALLESLDIPVRVD
LPGVGHHMQDHLAVSVAWSTEEDTQGTIFESGSEFSQSPEFLSFVNSGTSYVNGRFLFDG
QEQFDAYLQGLRDTFSSADDLAPLLPGTSDEVDEGYRTIYQTLVDKVYPEAGLVEMLYSI
NAAGRIIVQAAIQTPLSQGRLSINSTSIFDPPVVDPKYFSHPGDIVLMRQGVKQVRRMST
LSPLRDILGDELSPGPDVQSDEDIENWIRQNANTEFHPGCTCVMLPRDKGGVIDQSLKVH
GTANLRVIDGSIFPLSMSAHLMAPIYGVAEKAAELILNPPSSSGGGSGGKGGSSGGKGGS
GKNDEDDDESAAAGLSSSLFITVAGSLFTALLGAF

Enzyme Prediction     

No EC number prediction in KAG2012243.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	48	637	3.9e-168	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.74e-102	47	637	4	532	choline dehydrogenase; Validated
225186	BetA	4.41e-96	42	638	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.53e-52	50	637	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.79e-39	495	632	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.00e-25	119	373	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV88352.1|AA3_2	6.47e-186	48	636	27	615
QRW02509.1|AA3_2	5.18e-185	48	636	27	615
QRV73541.1|AA3_2	7.32e-185	48	636	27	615
QRW16771.1|AA3_2	4.37e-182	48	636	28	607
CCA74335.1|AA3_2	1.81e-181	37	636	34	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.00e-73	48	636	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.67e-71	49	636	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.42e-70	49	636	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.93e-68	47	636	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	5.80e-66	49	636	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	3.29e-150	47	638	45	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.29e-150	47	638	45	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q0R4L2|PDH3_LEUMG	1.11e-71	49	636	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	9.01e-70	47	637	12	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2V5GRB0|PYVF_ASPV1	2.84e-69	47	634	50	610	Dehydrogenase pyvF OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.015269	0.984705	CS pos: 20-21. Pr: 0.9477

TMHMM  Annotations     

There is no transmembrane helices in KAG2012243.1.