CAZyme Information: KAG2010557.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2010557.1
• CAZy Family: GH152
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984		110972.72	5.9792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000007:2550043-2553563(-)

Full Sequence      

MASSATVCTSLSGKWFWKQRNPGIGLQEELDNLPRGPEEGLKLTGPAHRESIVSSWNLTK
GGDVPSEIHVELLGAGIIPHPYRGFGEHEVQWIADSEWLWACSFSRPAEPEQAARVKSAI
LTFEGLDTISDVYLNGEKVIEADNMFRGYQYHLPNASVGVPLKGDNTLLLHFASAKALAK
QLEAEFGKVRAGSTNLGDPSRVYVRKAQYGWRWDWGPELMTCGPYRPITLTTIYHSVYVE
DIWTKAWVSPIANPNGTITSYLPSLAVDVTVAQVSEFEDRYCVEIVLLDPDSHNEIRTLK
SAKLGLPFSAANATRPDGHQKHAVVQLEWPDLRALNVQPWWPAGMGAQKLYLVEVRLLYH
RADDEANTPMVVQSIKKRVGFRSARLVENPLVEPDQYGKGTTFFFEINGERVFVGGSNWI
PADNFLTTLSEQRYREWLTLVRDGNQTMVRVWGGGIYEPDIFYDICDELGLLVWQDFQFA
CGVYPGVSSAAPDVAPKSYPAFVLNVKKEAEYNVKRLRHHPSIVVWCGNNEDYQMVLQWG
DVPHLPATVLYEDILPSIVKALTSFTISFGLSCQDVEASYVRGSPYGGQGWDTADPTVGD
VHQWNVWGGKELPYQEYGKLGGRFISEFGIPSFPALKTVQYWMEGADQSEWYAQSKAMAQ
HIRAGSYERRFAILMNENFRNVASSDFDRYRFNTQVMQSEAVSYAYRVWRREWRGKGKEY
CGGVLVWQFNDCWPVASWALVDYFMRPKPVYYTIRRSLEPIAVNILREVVQNRANDRPKQ
FYEYGATRSLGANLHIWAVNTTRKAVKVKLDIQYFDLESDWTSRNGVTSEFTLPPNQSTD
LLALVCPSPPTSRLRNTVGPGIDGSGTVVVLARLLDPSTNLVLARFVDWPQPFRYLHIPD
PQVDLNVLDVDLTTGDATIQLSVAKPAKCLWLEAEDKQALDGRTDQEREVKWNDNALDIV
PGDSQVVVARGLGKRKVKVTWLKD

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	841	8.3e-82	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.14e-66	62	755	32	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	9.50e-14	793	895	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
397119	Glyco_hydro_2_C	0.007	462	533	64	137	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV98035.1|GH2	1.85e-296	10	982	7	919
QRW12613.1|GH2	1.83e-289	10	982	7	917
QRW25365.1|GH2	3.09e-276	10	967	7	858
QRV83983.1|GH2	2.98e-274	10	982	7	895
CCA67509.1|GH2	3.20e-264	11	982	8	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	7.14e-116	33	765	15	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	5.20e-100	54	811	13	719	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.42e-100	54	811	15	721	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.54e-100	54	811	15	721	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.42e-99	54	811	13	719	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	4.26e-192	65	982	32	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q4WAH4|MANBB_ASPFU	1.52e-182	64	972	32	831	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	3.02e-182	64	972	32	831	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	4.01e-182	49	972	6	829	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|B0YBU9|MANBB_ASPFC	6.00e-182	64	972	32	831	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG2010557.1.