CAZyme Information: KAG2009792.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2009792.1
• CAZy Family: GH105
• CAZyme Description: trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	JAAGWA010000007|CGC5	65519.90	4.3649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000007:827243-829515(+)

Full Sequence      

MEKYRVALMALCSLGLALETAGQSASSDAPPVATATPSPTGGLNEPLPSQVPVPPRQEWC
TSEIFCAGPLLQTVNIAHVYPDDKTFVDKPTSKPPQEVLNDFRNISTNTTYGQVVAFLEE
AFSGEGLELEPLTLQNFNPEPAFLNNVTNPLVRAFSQAVHTFWTQLIRGTNQETVCGNTG
RCESTLIPLNHTFVVPGGRFREQYYWDSFWILEGLLESELNDIANATLQNFMDELDTIGF
IPNGGRTYYLNRSQPPMFIQMLARYVQVTGDTDILARGLPLAEKELAWWSSERSVSVQSP
FTNQTHEVYRYAVTNSAPRPESYLTDYLTANDPELPVLNETERADLYAELASGAESGWDY
TGRWYSPGGTSLRDLHVRSTIAVDLNSILYRSHVELANLYGSSNETAANRHREAAERIRQ
AILDLCWDSEKLAFYDFSILTNDRNEWFTAAHYYPFWSGIIPDEVLSSEEAAFGAFSSLN
LVLNRYNGTFPATFVDTHLQWDAPNSWPPHQYIVLQALRALPANVSSGPLPQPSDDESTF
SLVPAGQLGLEETELPGQPVTFSRNASATGSSADINRLDGTVFNGGKCHGR

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	80	522	2.2e-123	0.8655804480651731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.08e-107	80	519	3	440	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.89e-95	65	520	13	475	alpha,alpha-trehalase
224541	TreA	2.34e-69	68	520	59	485	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	5.74e-67	5	520	8	470	alpha,alpha-trehalase TreA.
237326	treA	1.99e-60	44	519	33	469	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI56844.1|GH37	1.06e-277	8	586	9	602
CCA76060.1|GH37	7.14e-211	23	586	45	658
AGM46811.1|GH37	5.95e-201	34	586	56	625
QRW20035.1|GH37	6.83e-200	37	586	59	625
QRV92208.1|GH37	1.42e-196	90	586	112	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	5.82e-56	61	519	45	472	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	3.27e-54	68	519	15	435	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	4.39e-53	68	519	15	435	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	3.62e-49	81	518	39	483	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.65e-48	81	518	39	483	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19813|TREA_RABIT	3.67e-95	47	523	18	484	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	1.67e-93	60	518	49	509	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	1.67e-90	60	518	41	497	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|O43280|TREA_HUMAN	2.19e-90	47	522	18	483	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	1.60e-87	47	518	15	476	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999727	CS pos: 22-23. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in KAG2009792.1.