CAZyme Information: KAG2008810.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2008810.1
• CAZy Family: CE4
• CAZyme Description: trehalose-6-phosphate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		101038.57	5.5589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000008:1906178-1910202(-)

Full Sequence      

MTVMDSFSEPYTREGDDISLEQVHENIKRLEEEHRKNGVPLSGRIIHVVHYLPVTATLNT
AQPRSGAPPTPPLEEDSTAASSSPDAAPAQQQQPATPSSKPVWSVGPRYGHAAMVSGIMS
LSATHEQLIVGWTGDILTPGANANASNTNTSADKVPSANVSLEERAALEEALKEYAGKDG
DTDHHSNTTYVPVWLDNKVAHGHYDGYCKTTLWPLFHYLLWQDVATEYASADSHYPYYEA
ANAAFAQRIAEVYQPGDLIWVHDYHLLLLPKLIRESIPDVVLGLFMHTPFPSSEVFRCLP
RRKEILDGMLGANLVCFQTYSYSRHFISTCIRVCGYESNSRGIDVDGHTTAVMHCPVGID
AERVARDIQRPGIQPKLEALRNLYEGKKIIVGRDKLDVVKGVVQKLRAFEKLLQDYPEWI
GNVVMIQVTSPALTDSPKLERLVSEIVAHINGEYGSLDFVPVHHYHQTLKKDEFYALLSV
ADLAVITPLRDGMNTTSMEFVIAQNDTNKSPSVLSEFMGISKTMEDALLVNPWNLGDVAA
AINQGLLMSDEEKARRHEKLYKVVTTHTSHSWAAVLAKMLLEQMGMQGLARQTPYIPKDQ
LESLYAKAEKRLFLFDYDGTLSPIVKTPSMAVPSEAVLEALERLSADPKNLVYIISGRDG
AFLEQHLGHLKNVGFSAEHGAFVRERGSAEWVNFTASLDMSWMSEVEEIFKYYTERTQGS
HIEVKKSSITWHYRGADPEWGLFQCRQCQDLLENNLANKRPIEVLVGKKNLEVRPIAVNK
GEIVKRILYKNPDAEFIFCAGDDKTDEDMFRALQLFPPGTTQVKMEAPLSVTLIEGGNQP
PVDLAIKPEAVFTTAVGHSSKRTLAVWHVTTPQEVVDHMLGLVNGPTPQGEGQEGQEGEK
EEGEVKANL

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	92	575	3.2e-157	0.9410526315789474

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	115	824	31	698	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	186	573	68	455	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	113	573	32	461	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	8.75e-168	191	888	165	932	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.14e-161	181	573	78	470	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW19244.1|GT20	0.0	114	909	1	781
CCA75087.1|GT20	0.0	19	889	22	900
QRW05410.1|GT20	0.0	4	864	1	822
CED83290.1|GT20	0.0	4	884	5	893
QRV91345.1|GT20	0.0	4	780	1	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.43e-118	103	574	57	517	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DX9_A	9.65e-116	593	877	3	296	Chain A, trehalose-6-phosphate phosphatase [Cryptococcus neoformans]
6JBI_A	4.36e-104	192	574	73	456	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	5.09e-104	191	572	84	466	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	9.82e-103	191	582	83	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	7.51e-190	24	884	14	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	5.34e-183	103	885	36	848	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54NU9|TPSB_DICDI	1.16e-170	160	823	106	760	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9P4D3|TPS2_ZYGRO	1.87e-170	103	885	31	855	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	5.30e-154	191	788	86	674	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAG2008810.1.