CAZyme Information: KAG2006921.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2006921.1
• CAZy Family: AA9
• CAZyme Description: glycosyl hydrolase family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		40909.41	5.2490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000009:574612-576183(+)

Full Sequence      

MFSPSFIRAIQVALLLPTTIVFASPVASNASVVQTRAAGGLADAAKAAGLRFFGASTTVD
QLNDEPYAELLSNTSDFNLVTSLEQFVWGSIERQPGQYDFSVADRLIAFAERNGQLVAGG
TLVDAVRHYRAPGYINPLPNKYPPDDIRVALEKFVTAVVSRYRGRVHYWDVARDVTFGRF
FSVEWGVGVTDYLQIALRAARKADPNVKLYVSNAYLEEFTGRNVTDFPAMLNLVKRLQAE
NVPIDGVNFWLDLFALPSIPPEGDFYSNLVSKFRQLEELGVEGTLGSTSIWTEEDRPWNP
PAAPLHAQVYRDVVRACKDSKACVGINLASLTDKYQILIDAGPINPYPWDKDLQKKEHIY
NAIRDGLVG

Enzyme Prediction     

EC	3.2.1.8:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	41	362	5.7e-42	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	2.88e-57	41	365	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	6.47e-47	88	363	3	263	Glycosyl hydrolase family 10.
226217	XynA	5.03e-29	18	365	7	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU22293.1|CBM1|GH10	8.18e-42	17	368	76	395
CAB05886.1|GH10|3.2.1.8	2.74e-41	48	366	26	330
CAB05665.1|GH10|3.2.1.8	2.74e-41	48	366	26	330
AEJ35165.1|CBM1|GH10|3.2.1.8	5.48e-40	18	368	65	393
AFR33047.1|CBM1|GH10|3.2.1.8	1.11e-39	44	368	85	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.17e-37	40	367	2	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3WUF_A	4.16e-34	41	367	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	8.06e-34	41	367	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6Q8M_A	8.59e-33	15	367	4	339	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1V6Y_A	1.01e-30	44	367	7	314	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60206|XLNA_AGABI	4.86e-42	48	366	26	330	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B7SIW2|XYNC_PHACH	2.18e-37	45	367	88	397	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	4.95e-37	45	367	98	406	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|Q8J1Y4|XYN5_MAGGR	2.33e-33	40	343	37	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	2.33e-33	40	343	37	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000390	0.999582	CS pos: 23-24. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in KAG2006921.1.