CAZyme Information: KAG2006090.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2006090.1
• CAZy Family: AA9
• CAZyme Description: trehalose-6-phosphate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1068		118570.17	6.8891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000010:1633282-1636995(+)

Full Sequence      

MGFAIPKITVAEAGESLRSISGGLENLRDVPSMEGDNNSPIHDNNQLLSTTSTTMSSFRN
HRVIIASLFLPTTVVVGESAPPTPERNFEDAPPISIPAIAARLASEKNKPLKSALAGKST
PHSSHTRTPSASGPLKSIVEDLKDKSRLTSPAVRSPATETANPFTKLTRFAEDTPTPGRA
TPKLDVLAPTSPPAIGRKGFRADGPSSRLHRKSRSRSRRPTVASPVSPVRELDPDSDSWH
FEPSTVCNGGLRNAIDSVGERLRKKVWVGTLGTPTDGFGEEVRKEIDERLLSQRESVPVW
IPDDEFQSCYDEFCHQVLWPCLHYAVPDAPKTKMFYESATYKQYKAVNERFADVIASIYQ
EGDIIFVNDYHLMLLPLMLRKRLPNTASIGFFMHVAFPSSEIFRCLSVRKDLLLGVLGAD
FVGFQTANYARHFRQTVSRILAFEALPKGIQLPEDKGDEQLTEGSVNGKNGRRVRDGLAD
QGRFVDVASVPMGIDVVQLKERMEDPEVEEWVQVLKQRYAGMKLLVGRDKLDEIQGVRHK
IAAFEAFLDKYPEWQGKVVLIQVALQTTESNELAGGVADFVSRINSRFSTLTYQPVVFLH
TQDLTFSQYLALLTVGDAFIVTSLREGMALRTHEWVECQSKKHGALILSEFTGTYSYSGF
RSCIAINPWDTRGTAKAIEQALTMSPEEARSRWEDLHNHVITQTAQNFVTAFLNRTLRSH
VAHLASLSQSGTDPSAVPVLDLPRLLPRYKHSMKRLILIDFEGTLWRRDLSHAGMAKTLR
KEDEWSEEDEDWPKESVEVLKALSEDRRNEVWVLSGLARTGVLGKVAKVVPKVGIVAENG
CFIRTRTSRNSEGQWISMVSHFNLTWKSACLEILNYFTERTPGSFVEEREASVVWRFWST
DTVDETNPDRQWARRQAAEAQNHIFDSLGERFGLRIIPGKNSFLVLPNNISRSTAISAIT
HPGGPARSPYIGRATWMTPDTDEFALHKSAGGGYVGYGGSGGMGGDGTVEETDFLLAISS
DERLLRRLNEDDGAETVSTSGKGTDARWRVDFEELGGMLKVLAGVTSP

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	216	715	2.3e-143	0.9705263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	5.42e-175	225	715	10	461	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	6.57e-168	225	715	11	467	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	7.28e-152	225	955	11	661	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	2.60e-146	267	715	64	476	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	1.70e-138	225	959	104	776	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW17916.1|GT20	2.16e-295	56	1059	4	937
CCA66498.1|GT20	8.02e-276	55	1060	1	1037
QRV89728.1|GT20	2.31e-267	59	1059	7	927
QRW03935.1|GT20	4.22e-241	59	1059	7	883
QRV75032.1|GT20	4.22e-241	59	1059	7	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	2.34e-89	228	713	10	459	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	2.63e-89	245	730	36	487	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	7.04e-83	280	713	116	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUV_A	2.72e-81	222	705	8	456	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVO_A	1.02e-80	222	718	15	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUI7|TPSY_SCHPO	3.59e-133	176	961	88	826	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|O14081|TPSX_SCHPO	2.03e-129	207	924	163	840	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|P38427|TSL1_YEAST	2.97e-116	239	904	346	940	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|P38426|TPS3_YEAST	6.18e-113	239	904	314	905	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|Q9SYM4|TPS1_ARATH	3.22e-112	225	959	102	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999134	0.000868

TMHMM  Annotations     

There is no transmembrane helices in KAG2006090.1.