CAZyme Information: KAG2005649.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2005649.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	JAAGWA010000010|CGC4	34262.11	4.4912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000010:621120-622341(+)

Full Sequence      

MRFSPLFASAALAFASQAFAQDYIIRNWCPEPIEWFIGLESQGTLATGASALRPNLGTSP
GFIYTTANGGIRDGQLVATRAGFFFEPNYWWYYIVRDGNSDNFNTGISITPSRLPEDGFC
TTAACRDGNCTTAARTPPVFNGGPPPADAPAPNPPGYRCKHSDTNFDITFCPGFNWPSAR
GAQVVPNGNTRKCMDVRGNALENGTPVQIYDCNDTDAQRWLLSFGSTQVRLAGTNFCLDA
GSSPGNGVQMKIWQCYDNLPAQQWYFTNDFRIALEGTGLCLDLPNGNTANSNVLQTWTCS
DGNTNQMWGIPDYL

Enzyme Prediction     

No EC number prediction in KAG2005649.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	185	308	7.3e-25	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	6.99e-25	187	308	7	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	7.02e-25	188	310	7	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	3.20e-20	187	310	3	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	5.75e-17	177	311	707	837	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	4.87e-14	226	308	2	82	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV14186.1|CBM13	1.52e-18	178	313	30	168
AUB23598.1|CBM13	1.52e-18	178	313	30	168
AFR93997.1|CBM13	1.52e-18	178	313	30	168
UOH83865.1|CBM13	1.58e-17	178	313	30	168
AAW46144.1|CBM13	4.73e-15	178	313	30	168

PDB Hits     

KAG2005649.1 has no PDB hit.

Swiss-Prot Hits     

KAG2005649.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999715	CS pos: 20-21. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in KAG2005649.1.