CAZyme Information: KAG2005561.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2005561.1
• CAZy Family: AA7
• CAZyme Description: endochitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		62989.15	6.9412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000010:423119-425246(-)

Full Sequence      

MTSPTTVAIAGHTTASSPRPHILYTVKVNSGGKEYVSHRRYSEFVTLHDILKDPFKLPPK
RLLVTYFIPSAWVDDALISERKSGLTNYLNNLLASPDFKNHSALTQFLLGEETSSPLLDP
SRFNINFDLEDALPSTLPRKAALSLAATRPTAAAVAAFAEEVDGSPKTSERAMTNAETIA
KVSSTMIYAAYYPAWSAGTHPPEKLDFSKFDILFYAFVMPNSSSGITWDGGDKDILRRLV
AAARKSGYGTKIVLSVGGWGGCYWFSQACSTANNRTKFCNALMEVVNQYGLDGIDLDWEY
PNSPGAGNPYSANDTANYLSLMKLLRNAMGPCKILSSAVAHLPWLGSNGRPLTNVSEFAA
IMNYICIMNYDVWGASGTPGPNAPYGNLCGTSKQPHASAQAALAQWKAAGFPANKQLLGL
ALYGWVSKSTKNVLTGAFMPTDDMVLLTKSETSSLDGNGEITFLNGAHPRPKDGAIAQSV
AVENADGEGSIAAASKDGDEGKKKADGLVTVQAADLRRWWGQQIPFKTIVSSGALVKKSD
GTYGQGGGFTMGWDNCSNTPYLFNTAQQTVISYDGMLELFRCADGD

Enzyme Prediction     

No EC number prediction in KAG2005561.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	188	574	8e-45	0.8344594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.75e-46	189	424	2	263	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	4.45e-46	189	443	3	256	Glyco_18 domain.
395573	Glyco_hydro_18	1.10e-38	189	425	3	225	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	9.24e-34	188	372	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119351	GH18_chitolectin_chitotriosidase	6.00e-29	213	424	31	244	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71457.1|GH18	2.11e-82	181	580	164	494
SJX66486.1|GH18	4.27e-82	181	580	165	495
UOP56895.1|GH18	2.86e-80	182	580	235	640
CDI56735.1|GH18	9.96e-79	181	580	162	508
QRV87962.1|GH18	9.29e-78	187	574	123	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	6.61e-36	189	579	5	332	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6KST_A	1.37e-21	190	425	11	259	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	6.02e-21	190	425	11	259	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6TSB_AAA	1.86e-20	202	424	46	262	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	2.30e-20	202	424	65	281	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	8.79e-18	183	438	380	624	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	3.19e-17	180	424	16	268	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	9.72e-17	202	424	43	268	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q5AM60|CHI4_CANAL	1.36e-16	191	424	27	263	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1
sp|Q6RY07|CHIA_RAT	1.78e-16	181	441	17	285	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999934	0.000110

TMHMM  Annotations     

There is no transmembrane helices in KAG2005561.1.