CAZyme Information: KAG2005486.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2005486.1
• CAZy Family: AA7
• CAZyme Description: aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		64722.16	8.7240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000010:241449-243633(-)

Full Sequence      

MRLATLSAFVALGVHLAEAKVYNSLDELLTSRAKKYDFVIVGGGVAGSVLANRLSEDRRS
NVLLIEAGPNDEGVEELRVPGYTYSGKINSTYYWGSVSTPQKGLGGRTIEFTRGHVLGGG
SSINGMVYTRGSQDDYDLWERESGDPGWSWKAMLPYFKKNEKFIPHTHRSVEGQYDPTTH
GYRGRTLVTLPWANSTEFYDRALKNSEIQPEFAYNIDVNNGKPVGLTWLQSTIGHGERSS
ASVSYLDPKTRQRPNLDILVNTYATRVLPVSNSISRTPDIRTVELIPRRRGNTLPIEQIR
RTTITAAKELILSAGAIGSSHLLLNSGIGDRKDLDEVGVKTIHHLPDVGKDLSEHMTVAL
SWNATGAIPPPVDPDAAYEEWKKHRTGPLVDLVGQQVLWARLPSDSPIFKQYKDPASGPT
SPHVELTLSGSGAGVGAFIVLLTPHSRGTIKIRSNNPTEEPLIDLGFLTHPFDILAFKES
IRLAKRFYSGPAWEGYITGFNGPDPDTLSDEEFLKRVQESTGSFYHPAGVTKISPKGSKK
GVLDPDLRVKGVKGLRVVDAGIIPYVPTSHTQASVYVIAERASDLIKASW

Enzyme Prediction     

No EC number prediction in KAG2005486.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	588	7.4e-151	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.44e-103	31	587	1	532	choline dehydrogenase; Validated
225186	BetA	5.28e-101	32	588	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.16e-35	444	582	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.97e-30	105	357	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.63e-17	36	575	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ82895.1|AA3_2	2.19e-139	7	588	9	603
VWO99077.1|AA3_2	6.47e-135	1	587	6	609
ALJ82906.1|AA3_2	2.83e-133	34	589	33	600
VWO99079.1|AA3_2	5.93e-129	34	587	40	607
AYF60129.1|AA3_2	1.78e-127	17	590	16	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.22e-126	36	588	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.84e-125	36	588	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.93e-121	6	590	12	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	2.11e-69	36	587	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4UDP_A	6.10e-60	36	586	6	527	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DO29|ERIK_HERER	1.87e-123	4	589	6	598	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q3L245|PDH1_LEUMG	9.91e-121	6	590	12	601	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	1.86e-120	6	590	12	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	2.44e-119	36	590	41	593	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.15e-118	36	590	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.232537	0.767454	CS pos: 19-20. Pr: 0.7458

TMHMM  Annotations     

There is no transmembrane helices in KAG2005486.1.