CAZyme Information: KAG2004732.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2004732.1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		71179.42	6.3944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000011:1493990-1496061(-)

Full Sequence      

MAISSRRMVRSLCALLACVVIVSLLPESLFSTTDHHSQRFVDVIVEQQPKTYRIPVPQIR
RKKKVEPAPEPATPVLEKHRFRSDGLLEVNLNGPHPIYELMSRAEKTWKSKLNHASRTLE
EAVEEYTRRYNRPPPKGFDHWWDYVVEHNVQLPDEYDQIFNDLEPFWGIEPEDLIAIQQE
AETKKDSYTVGKTEDGDVDVLTYAFEEGRYQQLIVGSRGVVSLLREVQDYLPPFRATFSP
HDGPNRMSDYNIKKRVLDAAASNQYVRRADLPKISGTGWRFACAPDSLPRRRPPNLDEPP
PRPAKKTFIHDHVRTMDPCIHPNHFHQHGQFLSHNMGPTPQDAMVPEFAQCSTTLHHNIR
YPTPYGWVEDIYPRSDDPPFDDKIDDRLSWRGRNTGIFHSSTTLWQNSQRDFLVGFANEL
EGSIKLLPPNVTETEPLGGLREMRKSRLNPAVMDIAFAEGPIACSESTCKELEAIYPFRP
YQGAKEAGQYKYVIDVDGNGWSGRFKRLMTSNALIFKSTLYPEWYADRIQPWLHYVPIQL
DLSDLHDALVFFRGDGNGEGAHEDLARTIAVAGREWSKTFWRKEDLVAYFFRLILEYARL
MSKDREAMSFVLSYDED

Enzyme Prediction     

No EC number prediction in KAG2004732.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	342	601	1.2e-59	0.904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.05e-20	330	601	16	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.29e-13	489	601	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV89460.1|GT90	5.99e-165	76	612	114	651
QRW03676.1|GT90	1.35e-163	76	612	114	651
QRV74770.1|GT90	1.35e-163	76	612	114	651
CCA67199.1|GT90	3.21e-159	76	610	87	623
CDR40950.1|GT90	8.10e-123	71	617	138	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.29e-14	338	602	110	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.01e-92	95	606	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.49e-13	440	617	316	485	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.50e-13	440	617	317	486	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.14e-13	338	602	138	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.85e-13	338	602	138	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.128045	0.871934	CS pos: 31-32. Pr: 0.7834

TMHMM  Annotations     

There is no transmembrane helices in KAG2004732.1.