CAZyme Information: KAG2004312.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2004312.1
• CAZy Family: AA3
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	JAAGWA010000011|CGC8	98215.98	7.8918

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000011:410686-413610(+)

Full Sequence      

MSLPTVNPSVESFASDETHIEFPSIMVEEEKKYSSEPHFIAPLPALPYLKAGSFPESPFN
NTPASPYLNRASTFDLDSGWRRRQAILRGEKRKVKLTKGHFIAEYRVPTAVHNAMEKKYT
CTKSTEFSHMRYTAATCDPDDFTEANGWSLRPKMYGRETELLIAVTSYNEDKALYARTLH
GVMLNIRDICKTQKSKYWRSCAEEGTPAWTKITVALVVDGLDNMDKSVLDLLATVGVYQD
GIMKKKVDGKDTVAHIFEYTTQLSVDDKPQLVLPQENDDGSNLVPVQIILVVKAKNQKKI
NSHRWLFNALGRQLNPEICVLIDAGTKPGYKAIYHLWEAFYNNENLGGCAGEIYAMGGKR
LLNPLVAAQNFEYKMSNILDKPFESSFGYVSVLPGAFSAYRYRAIQGRPLEQYFHGDHSL
ADRLGEHGINGMSIFQKNMFLAEDRILCFELMAKRGEKWTLGYVKDSKAETDVPETAPEL
IGQRRRWLNGSFAASIYALVHFWRVYQSGHNFVRIFFFHIQALFNAFNLFFSWFALANLW
LTFSIIIDLLPANIKGANLVFFHWFHLVLKYIYLGFLAMQFILALGNRPKSERVAYTASF
YVFSILSVYLIFSSLWLTASSFISLESDIARHNYKNTLEALKGMFETPIGPLTAAIVSTV
GIYLIGSILYLDPWHMFHSFVQYFVLAPCFTNILNVYAFCNLHDVSWGTKGSDTVDILPS
VKSKASLGSNEVVVEEATNTQEDIDHFFKETVVRALAKVEEVQTIEKPTMEDDNKTFRTH
LVGAWLITNALLALAIGNIGGWINVNDPKITAEQIHKFTIAGNDRRNMYFAFLLYATFIL
SMVRFLGSVFYWVRHYLFALCRKN

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	168	340	3.1e-67	0.9877300613496932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.09e-91	168	340	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.42e-90	163	494	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.53e-34	93	166	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	5.37e-29	289	612	115	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	7.88e-18	317	489	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF37219.1|GT2	0.0	63	864	128	938
BAF41224.1|GT2	0.0	63	864	128	938
QYK92506.1|GT2	0.0	31	864	61	895
CAB96110.1|GT2	0.0	72	864	110	896
ABW09311.1|GT2	0.0	71	864	114	913

PDB Hits     

KAG2004312.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VMX7|CHS7_CRYNH	0.0	47	864	99	931	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|P30598|CHS1_USTMA	0.0	81	854	145	909	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|P30602|CHS3_EXODE	2.12e-288	75	796	114	852	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	2.36e-286	64	848	110	895	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|P29070|CHS1_NEUCR	4.09e-286	70	847	116	900	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

Start	End
487	506
527	549
564	586
598	620
649	671
781	803
831	853