CAZyme Information: KAG2003337.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2003337.1
• CAZy Family: AA3
• CAZyme Description: endochitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		50900.46	3.9725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000012:1003295-1005084(+)

Full Sequence      

MRAQSILLSLLAASTSVWAAPAVFGRHEGHDHGSTDVAPQDADGTVVIPVTASGWYPSWY
KNVMPPSEIPWEKYTELTFAFALTTPDTSALTLEGEEETLRAFVQEAKANNVKALLSIGG
WTGSQYFSPAVASAENRTTFVKTITDMATEFGLDGIDFDWEYPNAEGIGCNLRTPEDTEN
FLTFLRELREHPVGVNLKLTAAAHITPLMDATGTPGSDMSGFAEVLDHLAIMAYDIHGNW
LDQVGANAPLRGSCPASPLGSVEGSVEAWTAAGFPAEKLLLGLPAYARSFTVAKDDVLDA
DGNIVTFNPAFDKESYPLGEGEVEGQVLTDKCGRPEFPAGLFTFNGLIAGGLLGTDGEAA
PGVVYGFDNCTETPFLYRESDSRMVSFDDARSFAAKGRFINEKGLAGFAVWHISGDTRNN
ILLDSIYEAMGIEVQDDCGSEEVGDDAGAEEGEEEGECPEVPPVPENAPLPSVSSSA

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	54	421	9.6e-65	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.78e-77	54	416	4	334	Glyco_18 domain.
395573	Glyco_hydro_18	6.72e-69	54	416	4	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	9.13e-67	54	416	3	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	2.99e-58	54	434	42	440	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	6.74e-56	75	413	29	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFD19009.1|GH18|3.2.1.14	7.03e-144	50	432	75	458
CAC35202.1|GH18	1.86e-128	32	433	31	432
ABB90389.1|GH18	5.13e-121	32	437	20	426
CAQ51152.1|GH18|3.2.1.14	5.34e-121	52	435	53	440
QRV99381.1|GH18	9.77e-121	45	441	39	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.38e-54	66	428	14	367	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	1.90e-37	111	426	122	415	Chain A, Glycosyl Hydrolase [Niallia circulans]
6JM7_A	2.05e-35	75	416	34	350	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	2.67e-34	75	416	34	350	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
1HKK_A	4.11e-34	75	416	31	342	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.90e-35	111	426	154	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.09e-32	75	416	52	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	1.79e-31	75	416	52	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|A5FB63|CHIA_FLAJ1	1.38e-28	108	431	108	464	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|Q9W092|CHIT2_DROME	3.78e-28	111	416	117	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000619	0.999359	CS pos: 19-20. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in KAG2003337.1.