CAZyme Information: KAG2003280.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2003280.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35013.89	4.3350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000012:887903-889197(-)

Full Sequence      

MFPSSKRLSAVLSSLLILSSDVAYGVKRYEIVNNCPLSANLYINHDAQGTLAANGGTVTR
EYSDEWDGYIFTDLNRGNARDRAGTIRAGFLNRFDFYWISYDQKWRNVGVSIQPVDAVQA
DGFCRPLECLVDACPQGAPYEPQRFPLPYDPTNGPPPTPIYGCPATTYRVTFCPDGEIPH
LQQGPNNIHPESSMEKCLDVRADLFENGTPVQINNCDDSPGQKWDIKRGGQQIRLYGTNF
CLDAGSSSPEEGAQVTIQQCSEGSPSQQWDYGTDDRISLPSSGQCIDLLNNDLTNGNRVQ
VLECLSEIPKQNWIID

Enzyme Prediction     

No EC number prediction in KAG2003280.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	195	314	8.9e-20	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.06e-22	196	313	12	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.13e-22	187	315	2	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	2.12e-18	195	315	7	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	6.43e-14	197	313	723	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411519	lectin_2	1.74e-11	197	313	129	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	7.07e-11	178	240	26	90
BAB20766.1|CBM13	7.90e-09	164	240	28	100
BAB20765.1|CBM13	2.91e-07	179	239	33	93
UOH83865.1|CBM13	3.52e-06	188	240	36	90

PDB Hits     

KAG2003280.1 has no PDB hit.

Swiss-Prot Hits     

KAG2003280.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000635	0.999332	CS pos: 25-26. Pr: 0.9674

TMHMM  Annotations     

There is no transmembrane helices in KAG2003280.1.