CAZyme Information: KAG2002967.1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: KAG2002967.1
• CAZy Family: AA12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34189.22	6.4065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinerea326	15250	N/A	238	15012

• Gene Location: location=JAAGWA010000012:146591-147923(+)

Full Sequence      

MRLSALYLALHSSALTLAASLLETRQTTPLTQYIVENQCPSAINLFIAGQLDSSIPSQGN
TTKFLPANAGFFYTDANGGNSNGLRTLRAGFYGEQFYYYMVKDPDYVNVGMNVAPQGVPS
RQGYCVSVGCSDVNCPTAFSSPPTRFPPSGSTAPNPPFYQCPIANTTYRITFCPGGQWPG
PETWRIHPGFNTAKCLDVRGAVFSNGTPVQIYDCNGTAAQNWILNRGATSIRLNGTNFCL
DAGSNPANGVGMKIWQCYDNLPAQQWFYRDDNRITLQNQAFCLDLTNGELTNSNQIQTWQ
CTDNNANQVWTL

Enzyme Prediction     

No EC number prediction in KAG2002967.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	191	311	1.4e-20	0.6329787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	9.34e-24	185	312	2	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	9.40e-23	189	310	7	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	2.35e-18	191	312	5	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	7.70e-17	175	312	700	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411519	lectin_2	2.47e-14	175	310	114	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	1.54e-52	186	310	37	162
UOH83865.1|CBM13	6.69e-38	182	311	32	163
AGV14186.1|CBM13	7.22e-38	182	311	32	163
AUB23598.1|CBM13	7.22e-38	182	311	32	163
AFR93997.1|CBM13	7.22e-38	182	311	32	163

PDB Hits     

KAG2002967.1 has no PDB hit.

Swiss-Prot Hits     

KAG2002967.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999620	CS pos: 25-26. Pr: 0.6370

TMHMM  Annotations     

There is no transmembrane helices in KAG2002967.1.