CAZyme Information: KAG1713046.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1713046.1
• CAZy Family: PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914		102706.05	6.5636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000001:2716900-2719767(-)

Full Sequence      

MNDGMNLEAILVDEEYLASASNGELGLSQPVRPVQIQTDKPQEEIVPPMMDARHRLIMVS
NRLPVSSQRNEATGERTFSMSSGGLVTALNGIRDQVPFIWIGWLGEEIPHDEQSAVREKL
TKEFNCIPVFLSKEIAARYYNDFSNDILWPIFHYVPLPLFRPGSEKKFDFRQWDAYKLAN
KRFAQAVNQVYREGDFVWVHDYHLMMLPSLLRARHPHCKIGWFLHTPFPTAEMYRMLPVG
KEILEGLLGADLLGFHTYDYARHFIAACGRVPGASTSPKGVEIGDHFSAIGVFPIGIDPE
HFEDILNSEATQKRVQELATKFAGCKVIIGVDRMDYIKGIPHKLLAMERFLSLYPERRKD
VVLIQIGVPSRTGVQEYQHLAASVNEMVGRINGRFGTLTHSPVHYIHRSVPPSELVALYN
VADVCLVTSIRDGMNLVSHEYVMCQSQSCEPHREGPGVLILSEFAGSAQSLSGAIRVNPW
NTTDMANALGYAMDLPLMEREYRQTNLYRYVKTHTASFWGRSFLADLEDAVSQPRAVVKK
LVRLPTVEVLGAYARSNHRLLVLDYEGTLFDDLTNTGPSQQRGNVAPPKPFVKRLIEALA
NDPKNTVVLVSAHDRNVIRSWLTDHRVGVVAESGYFYRLPNDEEWQVMTEDTDPSWKKVV
RPIMQYFTERTPGSRIDSKESSLTWHYGETDPIFGPMQARDMQVNLEDVLCNLPLEVVQG
TNRVEVRLQGVTKTLLLDEILKQFQPESEPNSPVSRGARLSPRQSRRQHLPPPQLDFVFY
AGNGVEDDELFLYFKEHLELARKEEGPSQQPSGGNDVLLPPSLSISTGDATSALSKRANV
FTCHIGGNKTEAMFHLERPSDLARMLRALAVHSRDGDMPRAPIDRGTSSDLPLAMSNSAV
HLSASMPSLSAFGK

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	51	528	7.3e-193	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	55	529	2	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	0.0	50	531	11	481	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	0.0	39	870	42	845	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
215556	PLN03064	0.0	42	876	85	933	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	55	528	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA16456.1|GT20	0.0	34	870	148	967
CCA20339.1|GT20	0.0	6	874	37	932
UIZ21560.1|GT20	0.0	10	530	128	655
AJA04606.1|GT20	1.70e-241	55	799	129	839
AGT80036.1|GT20	1.70e-241	55	799	129	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	6.66e-174	55	527	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	3.74e-173	55	527	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	5.29e-172	55	527	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	5.96e-171	55	527	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.41e-168	54	527	11	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	7.23e-225	55	747	17	680	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	7.70e-201	53	798	91	812	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	3.63e-190	53	871	11	773	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|P40387|TPS1_SCHPO	4.57e-181	55	528	20	482	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q00764|TPS1_YEAST	9.77e-181	56	532	18	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG1713046.1.