CAZyme Information: KAG1712721.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1712721.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	JADEVP010000001|CGC4	57475.55	4.1648

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000001:1647653-1649330(+)

Full Sequence      

MTLSVRFLGLLGLFSSTFSCCDAGSSFIDFRSVDGQLKADNETFHIKGINWFGAETIELV
VQGLWPSATTIGDALDLFASYDINALRLPLAMDSVVDDPKVKSTQTGGSESLAGKSYLEV
LDVIVREARKRNILIMFDSHRIEASEPDFPDVAVPDDITPALTKLATRYCNDPGAWNVFA
IDIKNEPKGKATWGKGDEDTDWNLQAAKIGNAVLKKCPRLLIFVEGVQTNIKGVSMKWGQ
AGGSLQGAKDYPVKLSNMERLVYSPHLISPGVDYKSPWWSDTSFPDNMPDLWDEYFGFVP
KETGQAVVVGSWGAQMKDKNKKWANAVSSYLEEKSIGSFYWAFNPQSADTGGFVKDDWVT
PIDERVALLETLPSTSVEDIVAIFAKCTKNCAGNGGCEGGKCVCYGGWSGPQCEICSEGD
TEACNEMGTCLGNSTCACEDDANGKYCAGTECDEVDCGDGSNAGCFNGECTCLYNCVGNS
CVVCAANDSALADASNGATILCGACDAQVLDDDFSSAQTATISLGIAALAAIASYFL

Enzyme Prediction     

No EC number prediction in KAG1712721.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	40	352	1.3e-82	0.9903225806451613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.28e-30	41	360	42	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.10e-25	63	345	17	270	Cellulase (glycosyl hydrolase family 5).
411343	exchanger_TraA	7.36e-04	391	496	305	398	outer membrane exchange protein TraA. TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24085.1|GH5_1	9.97e-314	5	537	2	526
BAU13557.1|GH5_1	5.54e-67	37	378	59	402
ARV61444.1|CBM2|GH5_1	9.21e-65	37	375	64	404
AFZ20162.1|CBM2|GH5_1	1.41e-64	3	381	12	402
UIZ28856.1|GH5_1	1.42e-64	28	361	5	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	1.80e-62	45	372	29	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	3.52e-62	45	372	29	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHM_A	1.96e-61	45	372	62	408	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHO_A	1.96e-61	45	372	62	408	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	2.74e-61	45	372	62	408	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	3.23e-60	48	360	58	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	9.41e-53	37	382	55	401	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	5.34e-48	23	376	20	372	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	1.31e-38	29	370	628	994	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|Q05332|GUNG_ACET2	1.75e-37	46	370	62	441	Endoglucanase G OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000896	0.999060	CS pos: 23-24. Pr: 0.6677

TMHMM  Annotations     

There is no transmembrane helices in KAG1712721.1.