CAZyme Information: KAG1711934.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1711934.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		52747.30	4.1801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000002:1985405-1986928(+)

Full Sequence      

MKGFRYGFIAAFVFATQYTAAINTGTAPGLASGATGGGDTDPVYPTTIDELTSYLSDDET
RVIILQQEFDYRGSEGSTTENGCRPLSNQECIAKNNGCKGQDVILQSGGMSGTGGCTDGI
SVQVTYDNAGPNPLQVQGNKTIRGVGTSGVIIGKGLWILGSNVIVQNIHITNLNPHLIWG
GDAIYIQGADGGETALENVWFDHVKISSIGRQMIATNTASVKSMTISNCDFDGYTEYSAS
CDNRHYWTMLFYGTETQVSLVNNYIHQTSGRSPKVGGNTILHAANNYFYNNSGHNFDPID
ESYTVAEGNYMDTCTEPILLDDDATGAIMVPSSDTQSYCESALGRDCVVNTVVTSDAELT
GQNEESAVTTAATVAKAYEPSAAATLALSSSNFGVGDLDVIDGSSSSGTTIATTSSTTSS
GSTASTTAASSIESTTSGGSTAASSSPASSESATASTTTPTTSSGSTTYTYTTTRSSTTT
SSSATTTSPSIRNENVNFQSQFGKFGK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	312	2.6e-80	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.19e-29	122	310	2	185	Amb_all domain.
226384	PelB	1.03e-08	97	323	51	285	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.05e-07	132	309	28	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19254.1|PL1_4	7.42e-288	1	405	1	405
ACR19247.1|PL1_4|4.2.2.10	6.67e-176	1	398	1	398
ACR19251.1|PL1_4	6.67e-176	1	398	1	398
ACR19255.1|PL1_4	3.82e-175	1	398	1	398
ACR19252.1|PL1_4	4.16e-165	22	398	56	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	1.48e-79	24	350	4	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	4.14e-79	24	350	4	313	Pectin Lyase A [Aspergillus niger]
1QCX_A	5.46e-76	25	350	5	314	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	1.46e-89	24	355	25	341	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.46e-89	24	355	25	341	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	9.87e-86	15	350	14	333	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q0CZD4|PELF2_ASPTN	6.56e-85	29	364	29	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B0YCL3|PELB_ASPFC	6.86e-85	25	363	24	344	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000451	0.999504	CS pos: 21-22. Pr: 0.9635

TMHMM  Annotations     

There is no transmembrane helices in KAG1711934.1.