CAZyme Information: KAG1711879.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1711879.1
• CAZy Family: PL3|PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	JADEVP010000002|CGC5	62838.76	5.5157

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000002:1767866-1769521(-)

Full Sequence      

MTLMCSCCFSQTPKKSPKVPATIAPESVVEPNEGAFATIMYDFGEDSESLLLATRVLMRS
IKDSNTKYRRMVIVPQDGLQESSERALKGDDPDLEIIKTNIPNVFAHMPLTDYRTQLLHM
RNKLVIWDDPQISSLKRVVYLDPENLVLRNLDEIFACYQFCAVDNGQSVVYSNGLLVISP
DSIAARNLYSDAIDGFMITGREYNYIGIIQGFMPGLFEAFEESPLFFLGWDGDDNGEESD
GADDGDDAVEADSSVVHRLPFYYSINHMVFYERMNWDLYKCKDKNLAKGEIPGPLLSYKY
SGATIKPWFWLPYTYFQVFWYWQDVRARLGEDNFGYFLGKVVSFSVIFAFIWFAYVWLCL
KLFTEPNGRPRRLSSWSLPTPGNAQPLTIDVFNSRVVRRACQFSCSALYAVASMPLLSSV
SIVVLLTWCSIQVIPITMQPSYAGKLWLIVHDLMLTTLLLIFAVAHTLRTAQWKKDEVPA
TSELLLGGVWWCVKKLPLLVLAQLQFLYMIGRTDWFQNPVLRPVMTFFFYGIAAFATGRI
LVVEMHRITRS

Enzyme Prediction     

No EC number prediction in KAG1711879.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	6.87e-15	35	213	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	0.0	40	551	1	515
CCA23792.1|GT8	6.60e-164	11	525	26	556
UIZ21271.1|GT8	4.64e-21	35	335	38	332
QCD81290.1|GT8	6.93e-19	35	328	49	300
BAT75850.1|GT8	1.66e-18	35	328	49	300

PDB Hits     

KAG1711879.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	5.39e-16	32	330	61	318	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	2.94e-15	32	310	57	294	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	3.61e-11	30	226	27	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|Q8GWW4|GUX2_ARATH	5.07e-07	31	209	298	461	UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GUX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999743	0.000304

TMHMM  Annotations     

Start	End
341	363
405	427
447	464
484	506
521	543