CAZyme Information: KAG1711739.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1711739.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		92427.57	6.8718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000002:1404334-1406799(+)

Full Sequence      

MVMSRAGSPVALVPPKTVLIVVNVLPLVFERSETSASGWSVSWATGATAMLYRTLVRDAD
QYSPLFIGCPEVFVAKSEEAALEKQLRALRCVPVFLDPPVAHRYFQGFCKGVLWPVFHNV
VDVYNSAELQLDCEENEGKRAKQWFPGQKEDSSGVKSAWCDPVSWNPAAQDMCWSDYCSV
NRTVARRVVESYHDGDLVWLHDFHFLMLPSYLLRRLRTALVTMYLHVPFPSSEIFRCLAM
RTEILRAMLCADHIGFLTFEHARHFLTSCKRLLGLDYKTCPNGMLVIEYNGRKIHISCSH
VEPDVTHLHEMLDKNVAEVNGAALEFAAHVKNAIMAGRDSEQRRIVIGSVDRLEGLTAIP
LKLRAFDRFLATHPEKRSSVVLVQIGISLDSRPNDYHRTRDNVLKFTEEINRRYAPPGGV
VVYFEEKRKTTCAERVILWRMCDIYLDTCVRGGLSLLPFEYMIAQHRNIQSKAKNSAGTG
WSSPRGTIDVGGLDRSFGIMIVSEFSAYSRILSGSLAVNPWKTDDMVGALAKACGMSYYE
KHNRFYMNYKFVVGRSDSTPWGERLLTDVEAVTEKMEDASTGEVVQVGFGFDFRVMRFES
GFVCLDVDELVKKCANTSRRLFIFDYGGTLSSTANILDEEGARFSHRPGCVEQSAENADS
SDRSGGDCTGRSAARYVDGKVRKPISDETRASLRTLCVDPCNIVFVTSNTQRGALEDQFD
SIPNLNLIAENGLFIRMGGQTRWECVCEEDKRSFGWKDDVKRVMEAYAARTNGSFLVENA
ASLLYDYRNSDQEYGEIQSLELCAQLRKIVEVCIKVILSSR

Enzyme Prediction     

No EC number prediction in KAG1711739.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	16	570	7.6e-106	0.9705263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	1.07e-114	11	810	55	740	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
340820	GT20_TPS	1.42e-106	18	570	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	4.74e-96	18	809	3	634	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	4.64e-95	18	571	3	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	1.20e-83	17	806	12	651	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19238.1|GT20	9.15e-133	67	811	323	978
UIZ27356.1|GT20	1.55e-132	14	811	20	727
UIZ24099.1|GT20	2.42e-129	7	811	281	1020
AGT20052.1|CBM20|GT20	5.66e-112	18	811	175	882
BAM80147.1|CBM20|GT20	1.88e-102	4	810	204	886

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.30e-64	19	573	15	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	9.40e-64	19	569	14	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	4.45e-62	19	569	3	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	2.20e-61	18	569	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.10e-60	18	569	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O23617|TPS5_ARATH	6.66e-94	18	810	62	735	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q94AH8|TPS6_ARATH	1.70e-91	14	810	51	746	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|Q9LRA7|TPS9_ARATH	3.50e-87	19	810	62	735	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	1.18e-86	19	810	53	727	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1
sp|Q9LMI0|TPS7_ARATH	4.79e-85	19	810	62	729	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998594	0.001411

TMHMM  Annotations     

There is no transmembrane helices in KAG1711739.1.