CAZyme Information: KAG1711632.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1711632.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48944.96	5.5490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000002:1135379-1136727(+)

Full Sequence      

MLAHLQLIVLLYLVLPRLSSSNTTEESQAQWLQAPSGASTSMSACAFTHMHPRRYGAYHL
PPQPDPFSPSITIDGVLDEKVWAEVPWSESFQDIRGPTFWSQPWFTTKFKLRYDQKFLYI
GAYIEETEVWANVSQRNEVIFHDNDFEVFVDADGTTHNYKEFELNARNATWNLWLNRPYR
NGGHENSTRVDPHFGFDMLNGGMQSAVFVRGPINDPAERLHYWTTEIALPLSKLALHSTA
QVPPKPNSFWRINFSRVEWPVRVITDGSTGKQHYEKKTDLKEENWVWSAQYKVDMHQPEW
WGYLQFRPQGETPPELIDTDEVVPFDPAWGVRYVSFQFYYAQHAFHSAMGKYTASLEQLV
PYFTNREAVQCTKLLEVTATDKAFSAQIGLRAVPFDDGSEFIASIKEDGYISVEKALHAK
TIAIE

Enzyme Prediction     

No EC number prediction in KAG1711632.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	73	261	2.9e-30	0.8351648351648352

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187678	CBM9_like_3	2.51e-53	73	303	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
187676	CBM9_like_2	4.69e-15	68	257	8	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
399451	CBM9_1	0.007	73	170	1	97	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UBZ09150.1|CBM0	2.56e-64	46	409	17	345
UII25170.1|CBM0	1.10e-63	68	323	37	277
QXD16319.1|CBM9	2.08e-63	52	415	32	364
BCM88676.1|CBM9	4.08e-62	52	359	5	280
UOK64684.1|CBM0	2.67e-60	71	409	27	335

PDB Hits     

KAG1711632.1 has no PDB hit.

Swiss-Prot Hits     

KAG1711632.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999788	CS pos: 21-22. Pr: 0.9530

TMHMM  Annotations     

There is no transmembrane helices in KAG1711632.1.