CAZyme Information: KAG1711299.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1711299.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		85458.39	4.4014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000002:194631-196976(+)

Full Sequence      

MLKSWQSAVCYTALSLAVFSNSFTAADEWDSKVDEIMANFTNVDLVGQMTEIAAYGLLNS
TNQLDEEALRGFAKYHVGSYLSPPMSIKGEIDGKWGWTTAEMRAFVQRIQEIAMEENGGH
PMIYGTDSAHGNAMVMDTVYFGQQINAAATFNPDLVYEQGRITARDTLASGIPWVFDPVL
DIMHNPLWPRVYETFGEDPHLASIMGAAITRGIQSYPEAAACMKHWIAYAWNPTGHDKDG
VEMSDFDLMNTYFPSFKAAVDAGLLTGMENYISVNGVPVVENTKLMTKLLRDDLKFEGLM
VTDYAEINHLTEFHRTARNTDEATKFSLERTSIDMSMVASDLSFTNGTMKLIEEDPAIVD
RLKTSVRRIIKTKLKLGLYDNPMPGAEYVDMVGNDDDVATALDLARESTVLLQNNDSTLP
IAKTSSVFLTGPIAHNIGRQCGGWTVQAQGVSGNDMFSHGVSVKQGFEAVAGGDAFTYFN
GLNITGNYTETDLATAKEYAAKAEYTVAVIGEEVYEEKTGDIDDLTLPLGQIEYVKELAS
TGTKVIVVLFEGRPRILNDIPEHVYAVINGMLSCEQGGKAVAEIIYGDVNPSGRMPITYP
KDTGNVMIPYRHRVSTQCASGDYCKPQWIFGHGLSYTNFTYSDMSISTTNVTSSSDSVNV
SVTVTNSGSVAGKETVMLFLTQPYRSISVPEVKQLKKFSKISLVAGASQTVSFELTAADW
SVYYPQIGQGLKLVAEDADYVVAIKPETDCDVYNETAVANPLCATFTLSTGEYPFGSLVA
E

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	322	9.4e-55	0.9120370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	8.21e-105	98	744	85	750	beta-glucosidase BglX.
224389	BglX	1.41e-62	60	472	14	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.44e-45	141	713	114	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.89e-45	46	370	6	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.67e-43	409	636	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.92e-298	1	768	1	762
UIZ29613.1|GH3	1.40e-275	1	774	46	825
UIZ29432.1|GH3	2.14e-268	1	774	1	769
UIZ27116.1|GH3	1.21e-261	49	768	1	724
CCA27737.1|GH3	2.24e-260	31	768	66	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	7.92e-119	30	760	14	755	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	6.73e-81	88	744	54	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.44e-80	88	744	54	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	2.84e-79	106	744	68	736	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.59e-76	98	744	54	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	4.20e-131	30	744	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	5.80e-118	30	760	36	777	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.62e-78	90	751	32	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	4.93e-77	13	715	18	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.50e-76	13	715	18	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004717	0.995242	CS pos: 25-26. Pr: 0.9568

TMHMM  Annotations     

There is no transmembrane helices in KAG1711299.1.