CAZyme Information: KAG1710861.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1710861.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39008.55	8.6581

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000003:1093695-1094923(+)

Full Sequence      

MLRRVAVRAAQASAASAAKTRSFATSQLRTASKKKQPSAIVLAAAGVAAVGGLALTDLVN
AREKPVDLDAIKKEIVEIFDEDNYMGPTMVRLAWHSSGSYSKHDGSGGSTGGTIRFDPEI
NHGGNAGLHLAVKALEKVKKNHPEITYADLYILAGVTMIEEMGGPEIPFRLGRPDAKSGK
EPTQTPDDRLPNADMGSKEKTTQHVRDVFYRMGFDDRDIVALVGAHAIGRCYPTRSGYSG
PWTNAEWTFSNEFFRELIENKWTIKKWNGPMQYEDPTGKLMMLPADIVLIQDPKFKKIVE
EYAKDEDLWFKDFSKAFVKLTENGVKFPETSGWPTQTSIQELLKRLILFPTV

Enzyme Prediction     

No EC number prediction in KAG1710861.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	71	324	8.2e-59	0.9607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	2.82e-139	59	328	4	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	6.89e-73	87	344	32	263	L-ascorbate peroxidase
166005	PLN02364	1.02e-58	86	324	33	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	2.70e-58	69	322	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
223453	KatG	9.69e-56	59	329	58	421	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	9.49e-205	1	333	1	335
QKY15243.1|AA2	9.75e-98	64	331	92	368
UKZ92149.1|AA2	2.47e-91	60	331	79	342
QGI58483.1|AA2	6.36e-90	70	341	92	358
QGI89392.1|AA2	6.36e-90	70	341	92	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3M23_A	1.24e-76	69	334	21	280	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.36e-76	69	334	24	283	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]
2XIL_A	5.45e-76	69	334	24	283	The structure of cytochrome c peroxidase Compound I [Saccharomyces cerevisiae]
3R98_A	7.47e-76	69	334	23	282	Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],3R99_A Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],4XVA_A Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_C Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_E Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_G Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C]
2XJ5_A	7.71e-76	69	334	24	283	The structure of cytochrome c peroxidase Compound II [Saccharomyces cerevisiae],2XJ8_A The structure of ferrous cytochrome c peroxidase [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	6.38e-92	69	327	100	352	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	7.26e-89	67	331	86	348	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	4.11e-88	70	341	92	358	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	6.21e-86	79	336	130	379	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	1.19e-85	79	329	106	348	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999870	0.000194

TMHMM  Annotations     

Start	End
39	61