CAZyme Information: KAG1708657.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1708657.1
• CAZy Family: GT41
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1448	JADEVP010000006|CGC3	161923.34	5.4255

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000006:321584-327108(+)

Full Sequence      

MGLFGRKRASSRVAEGGGGVLATASLSTAASPPLGKHGGDLELFGADSDESDDEATIDRY
AKEGGDEELDEKEAAEAEKRKVAVLNSKLSPEELFLKYDTDKSGNISASEFLAMLPDLGI
SISAAKAMRIFRKCDTDGGGEIDLTEFKMAMFAVDPVSGNPLGFSPSTLLGPRDAFELFD
EDGTGQIDELEFADVLEYFGMSVSDEKQEKIFRKYDKDRSGYIDYQEFRSMWIRLIDVRE
ELTKRGVEVPKHTRLVRLQQMLETILDEEEAREALALEEAQRFLQRQRDKELREQLGRKA
IIRAEDELAAALDAAGQVYIIGSGKYDQFVGDPVTRDESLYPGFKAVSEIWSYRVNPTSQ
APPIKAASKTTKQQKDMDENPETTGRPKSQQLVADSEPESQINVPVFKYVRRRIENKRWK
FQSPPRLNKQSISETKALIRTLARENDMASERTEENANNPTESSDVEEITHDGDNQDEEE
LAKLFFENREFVRSLRFRSTTLMTNTGPLWGRSVVQGAISDSVAFAVTISGGVFSWGGRN
STWEASARRLAGFDSDSEEEMEGAEEKKTREETETGVKVTPRSALIKMCTPEQLRGLRDP
GVEAREEEQLEIGARQNEENLRYERLKRVVMYYDVWELPPSNTTRLLFMEQVLLPKVEYE
QLINSGRLRGLEFDHITKMDLCLVMGECFELEVEAKGEPGHAAFKDQEKVIKEYSEDKKP
QSKQVNLLQAEKDKMLQEWQDVKTLRESRHAKREEDARAKIIEKIDRADRAYESRASRRV
VQLEDTTPEFTARGGNSRINMSGVTTRGPPLHSPRGAVAVANVSAGGSHVALLMQDGSLY
TCGIGSSGRLGLRPNERGAICFDTNHPQRVEAFNDLSLRQVSCSFSHSAAIDSDGSLYTW
GSACNGKLGVGIVEEEYKQYSLTPLLVKFPGKRKIRSVSCGASHNGAVSTTGELFMWGSA
NGGRLGLGPHVIDTVVVPTLVRDLVNKKVRVWQVSCGMAHSAFCTEVTSEFNGGSKKLLG
GQVYVCGGATALGRHVLSWERIQELDGVGIRQVSCGGSHTAVVSSYGELYTWGRNYHGCT
GHDIDRGIIEKPELLKCLHVEPYNLAFGKVCRQISIYNEQGPHLAVNGETGGALATCIHT
QMEDSPWWEVDLGQPAVIEKIRLWNRTDEPLNPSKSRSEYSNRLFPCWIFVSEFPFKDLE
GKEGLRAAKVQSSAVELFRSNKRMTEWILPTANTVGQFVRVQLQNRNFLHFAEVEVLGVY
SAFKYVGKVGTVRCSTDATLVIMPPTSNQSVLDEYYLRAIQADADNATILRQYDAYERSF
RKFGRGVADTLDGPCRLCRVFRDCEVCEFYASAKYNRRSFVGNGLKPLPVRLVGDRMGLQ
ELVQVALAEGTLEADQQERLRQEQEAERAQQAAEAHRSAEEERTKKQSRLLNPFQGLAFR
VKKLDVKL

Enzyme Prediction     

No EC number prediction in KAG1708657.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1114	1254	8.3e-19	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	1.55e-28	806	1082	94	374	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	9.64e-21	82	234	7	156	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	1.36e-18	828	1085	59	321	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	2.04e-17	809	982	275	440	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
320055	EFh_PEF_Group_I	1.12e-16	126	230	1	91	Penta-EF hand, calcium binding motifs, found in Group I PEF proteins. The family corresponds to Group I PEF proteins that have been found not only in higher animals but also in lower animals, plants, fungi and protists. Group I PEF proteins include apoptosis-linked gene 2 protein (ALG-2), peflin and similar proteins. ALG-2, also termed programmed cell death protein 6 (PDCD6), is a widely expressed calcium-binding modulator protein associated with cell proliferation and death, as well as cell survival. It forms a homodimer in the cell or a heterodimer with its closest paralog peflin. Among the PEF proteins, ALG-2 can bind three Ca2+ ions through its EF1, EF3, and EF5 hands, where it is unique in that its EF5 hand binds Ca2+ ion in a canonical coordination. Peflin is a ubiquitously expressed 30-kD PEF protein containing five EF-hand motifs in its C-terminal domain and a longer N-terminal hydrophobic domain (NHB domain) than any other member of the PEF family. The NHB domain harbors nine repeats of a nonapeptide (A/PPGGPYGGP). Peflin may modulate the function of ALG-2 in Ca2+ signaling. It exists only as a heterodimer with ALG-2, and binds two Ca2+ ions through its EF1 and EF3 hands. Its additional EF5 hand is unpaired and does not bind Ca2+ ion but mediates the heterodimerization with ALG-2. The dissociation of heterodimer occurs in the presence of Ca2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARF14915.1|CBM48	2.82e-14	820	1078	93	328
ARF18102.1|CBM48	1.10e-13	820	1078	91	326
QQX77088.1|CBM47	1.10e-12	1104	1258	203	340
UCA56570.1|CBM47	1.10e-12	1104	1258	203	340
AZM48718.1|CBM47|GH29	1.19e-11	1040	1256	653	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4DNV_A	6.95e-25	818	1101	109	369	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
6XZM_A	7.29e-25	818	1101	112	372	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
6XZN_A	7.29e-25	818	1101	112	372	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZN_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
4NC4_A	7.78e-25	818	1101	108	368	Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_B Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_C Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_D Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana]
4DNW_A	9.98e-25	818	1101	109	369	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9VR91|HERC2_DROME	7.50e-27	822	1093	3023	3275	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|Q8IVU3|HERC6_HUMAN	8.88e-27	824	1082	29	270	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
sp|Q4U2R1|HERC2_MOUSE	4.27e-25	801	1174	2976	3351	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
sp|O95714|HERC2_HUMAN	5.58e-25	801	1174	2975	3350	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
sp|Q9FN03|UVR8_ARATH	1.30e-23	818	1101	120	380	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000014

TMHMM  Annotations     

There is no transmembrane helices in KAG1708657.1.