CAZyme Information: KAG1706915.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1706915.1
• CAZy Family: GT2|GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		96086.03	5.5058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000009:1243517-1246036(+)

Full Sequence      

MEKYKQYYGDKLLCVELDGELKTERCSPMMDPNVQFNVLPIGNYTAQAFITDKGKELRYH
RSSVSTFSVVSEETLASHADSLYMVEEQSLIEWAMLQEELQPPDGQMNGTISMWNYTDTF
LVIGVKTALTDGFALRQAIRQTWASSSSLPINVKVFFIGCVPKFRDTHEQERLRKAISLE
KHTYKDLLTDELRCEDSYADLSNKVKEFLRFAAERFPLTPFVMIADDDIYLRAGLLVEEL
RKEDRFPQQFYLGQVWDEILGRNQIPVRDAAERYYISEEDYPLHTYPPFAFGPHYLLSMD
CVRFIAKNSDRLRGLGAMDDVSVALWLLPIRVRVEHMRSFSNLRLRDCDNRILSLADLSP
FGIRSIDANIVGHRNLCDGFNQVTWLKHSQNEVNIESHICNLSESTYLEIASIISVRGKD
SIELSFYPSFETIKAYTRRVCAEIYILIANTNAVLCQRVGNELRKQLQKDLESVESAENI
DRARLEMWRYNLFVADTDASPLVIAYELSARFAAVIYECLFVVIYERYKRPILVVPSETL
HKHYGDFPNVFIFSVFDAGCGSVIQTTCLPGIAAFMDKYVLPDDAQIQNRSTKVMMVVGE
PTDTQGLDERVILLSTVSIMNRKKYVYLPVASFSFSERLDHPPTALLEPMTSSMATERRR
FCAYLYARCDRPQREYMFDVLNAMEPVDALGICAGSSRPPDPSYMASRFLISYNDDAVNM
FRNYKFVIAFENSGMPGYVTEKLVNPFLAGSIPIYLGNSTTVSGVFNTKSFIDCGRFERL
RDCALFVMKVHKSPELYEQMRREPPIKNVTAFLSIFSWHPSVPSRSMADQLAALLDDRN

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	136	336	1.5e-36	0.9791666666666666
GT10	650	803	1.6e-35	0.41210374639769454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	2.03e-27	136	338	3	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	1.42e-13	673	797	17	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	3.32e-09	121	327	387	579	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEJ34901.1|GT10	1.24e-19	595	804	14	211
QGR54220.1|GT10|GT25	4.13e-19	583	821	370	597
QWP29999.1|GT10	4.45e-19	653	804	120	265
QWP06209.1|GT10	4.45e-19	653	804	120	265
QWP23613.1|GT10	4.45e-19	653	804	120	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WMN_A	5.30e-15	120	358	110	339	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_C Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_D Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_A Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
7JHK_A	5.59e-15	120	358	116	345	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHN_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
7JHI_A	6.30e-15	120	358	130	359	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
6WMM_A	1.27e-14	120	358	110	339	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMM_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
2NZW_A	1.02e-12	658	809	179	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q864U8|B3GN5_PIG	2.63e-19	118	325	85	287	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Sus scrofa OX=9823 GN=B3GNT5 PE=2 SV=1
sp|Q5UQ63|YR654_MIMIV	8.88e-19	595	804	369	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q9BYG0|B3GN5_HUMAN	1.20e-17	118	325	87	288	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
sp|Q8BGY6|B3GN5_MOUSE	1.22e-16	118	325	85	286	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
sp|Q9JI67|B3GT5_MOUSE	1.02e-15	120	339	56	260	Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAG1706915.1.